KEGG   Delftia acidovorans: Daci_5660Help
Entry
Daci_5660         CDS       T00620                                 

Definition
(GenBank) chaperonin Cpn10
  KO
K04078  chaperonin GroES
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dac03110]
    Daci_5660
   03029 Mitochondrial biogenesis [BR:dac03029]
    Daci_5660
Chaperones and folding catalysts [BR:dac03110]
 Heat shock proteins
  HSP10
   Daci_5660
Mitochondrial biogenesis [BR:dac03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Daci_5660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: ABX38288
UniProt: A9BXL2
Position
6294741..6295031
Genome map
AA seq 96 aa AA seqDB search
MNLRPLHDRVIVKRLENETKTASGIVIPENAAEKPDQGEVLAVGPGKKNDKGEVIALNVK
VGDRVLFGKYSGQTVKVHGDELLVMKEDDLFAVVEK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcgtcccctgcacgatcgcgtgatcgtgaagcgcctcgagaacgaaaccaag
acggcttcgggcatcgtgatccccgagaatgccgccgagaagcccgaccagggcgaagtg
ctggcagtgggccccggcaagaagaacgacaagggcgaagtgatcgctctgaacgtgaag
gtcggcgaccgcgttctgttcggcaagtacagcggccagaccgtcaaggtccatggcgac
gaactgctggtgatgaaggaagacgacctgttcgcagtcgtcgaaaagtaa

DBGET integrated database retrieval system