KEGG   Delftia acidovorans: Daci_5661Help
Entry
Daci_5661         CDS       T00620                                 

Definition
(GenBank) chaperonin GroEL
  KO
K04077  chaperonin GroEL
Organism
dac  Delftia acidovorans
Pathway
dac03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dac00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Daci_5661
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:dac03019]
    Daci_5661
   03110 Chaperones and folding catalysts [BR:dac03110]
    Daci_5661
   03029 Mitochondrial biogenesis [BR:dac03029]
    Daci_5661
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dac04147]
    Daci_5661
Messenger RNA biogenesis [BR:dac03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Daci_5661
Chaperones and folding catalysts [BR:dac03110]
 Heat shock proteins
  HSP60 / Chaperonin
   Daci_5661
Mitochondrial biogenesis [BR:dac03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Daci_5661
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Daci_5661
  Exosomal proteins of other body fluids (saliva and urine)
   Daci_5661
  Exosomal proteins of breast cancer cells
   Daci_5661
  Exosomal proteins of colorectal cancer cells
   Daci_5661
  Exosomal proteins of bladder cancer cells
   Daci_5661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: ABX38289
UniProt: A9BXL3
Position
6295078..6296721
Genome map
AA seq 547 aa AA seqDB search
MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
ELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGLNPMDLKRGI
DKAVAALVEELKKQSKATTTSKEIAQVGSISANSDESVGSIIAEAMDKVGKEGVITVEEG
KSLANELDVVEGMQFDRGYLSPYFINNPEKQVALLDNPFVLLFDKKISNIRDLLPTLEAV
AKAGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV
IAEEVGLALDKVTLEDLGQAVRIEIGKENTTIIDGAGQAAEIEARVKQIRIQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL
RAKQAVGDLKTGDAEQDAGIKLIMKAIEAPLREIVANAGGEPSVVVNAVLNGSGNYGFNA
ANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMIAESPKAEGGPAMPDMGGMG
GMGGMGM
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaaagacgtagttttcggcggcgaagcacgcgcccgcatggttgaaggcgtg
aacatcctggccaacgcggtcaaggtcaccctgggccccaagggccgcaacgtggtgctg
gagcgctccttcggcgcccccaccgtgaccaaggacggtgtctcggtcgccaaggaaatc
gaactcaaggacaagctgcagaacatgggcgcccagctcgtgaaggaagtggcctccaag
accaacgacatcgccggtgacggcacgaccaccgccaccgtgctggcacaggccatcgtc
cgcgaaggcgccaagtacgtggccgccggcctgaaccccatggacctcaagcgcggcatc
gacaaggctgtcgccgccctggtggaagagctgaagaagcaatccaaggccaccaccacc
tccaaggaaatcgcccaggtcggctcgatctccgccaactccgacgaatccgtgggcagc
atcattgccgaagccatggacaaggtcggcaaggaaggcgtgatcaccgttgaagaaggc
aagtcgctggccaacgaactcgacgtcgtcgagggcatgcagttcgaccgcggctacctg
tcgccctacttcatcaacaaccctgaaaagcaggttgccctgctggacaaccccttcgtg
ctgctgttcgacaagaagatcagcaacatccgtgacctgctgcccacgctggaagccgtg
gcaaaggccggccgtcccctgctgatcattgcagaagacgtcgaaggcgaagccctggca
acgctggtggtcaacaccatccgcggcatcctgaaggttgtggctgtcaaggctcctggc
ttcggcgaccgccgcaaggccatgctggaagacatcgccatcctgacgggcggcaaggtc
atcgctgaagaagtgggcctggcgctggacaaggtgaccctggaagacctgggccaggca
gtgcgcatcgaaatcggcaaggaaaacaccaccatcatcgacggtgctggccaagctgct
gaaatcgaagcccgcgtcaagcagatccgcatccagatcgaagaagccaccagcgactac
gaccgcgaaaagctgcaagagcgcgtggccaagctggctggcggcgttgccgtgatcaag
gttggcgctgccaccgaagtcgaaatgaaggaaaagaaggcccgcgttgaagacgccctg
cacgctacccgcgctgctgtggaagaaggcatcgtggccggcggtggcgtggctctgctg
cgtgccaagcaagccgtgggcgacctgaagaccggcgatgccgagcaggacgccggcatc
aagctgatcatgaaggccatcgaagcgcccctgcgcgaaatcgtggccaacgccggtggc
gagccctcggtggtggtcaacgccgtgctgaacggctcgggcaactacggcttcaacgct
gccaacgacacctacggcgacatgctggaaatgggtatcctggacccgaccaaggtgacg
cgtacggccctgcagaacgccgcttccgtggcatcgctgctgctgacgaccgaagccatg
atcgccgagtctcccaaggctgaaggcggccctgccatgcccgacatgggcggcatgggt
ggcatgggcggcatgggcatgtaa

DBGET integrated database retrieval system