KEGG   Delftia acidovorans: Daci_5664Help
Entry
Daci_5664         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_20 HTH_5 HTH_24 HTH_28 HTH_Tnp_ISL3 HTH_50 HTH_23 HTH_AsnC-type MarR HTH_IclR Mga
Motif
Other DBs
NCBI-ProteinID: ABX38292
UniProt: A9BXL6
Position
6299802..6300722
Genome map
AA seq 306 aa AA seqDB search
MLLSRRFLPPMSLLCAFEAAARHQSFTAAAAELHLTQSAVSRQIRALEERLEAELFVRER
QTVRLSPAGQAYAQEIRGALMRISTATLGFRANPRGGSLNLAILPTFGTRWLAPRLPQFF
SAHPGITINLTTRLSQFDFQLEAVDAAIHFGLPHWPGAELAFLMSETVVPACSPALLAQH
GFAQPQDLLQAPLLHLASRPDAWQRWLSVHHAPMAEGQGMLFDQFATAAQAAIAGVGVAL
LPRFLIERELAQGDLVRALPHLPEMESAERYYLAWPTSRGNYPPLQSLREWLQQAAQDFM
RDGPQP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtcccgccgtttcctgccccccatgtccctgctgtgcgccttcgaggcggca
gcccggcaccagagcttcacggcagctgcggccgagctgcacctgacgcaaagcgccgtc
agccgccagatccgagcgctggaggagcggctggaggcggagctctttgtgcgcgagcgc
cagaccgtgcggctcagtccggccggccaggcctatgcccaggagatacgcggcgcgctg
atgcgcatctccaccgccacgctgggctttagggccaacccgcgcggcggcagcctcaac
ctggccatcctgcccaccttcggcacgcgctggctggcgccgcgcctgccgcagttcttc
agtgcccacccgggcatcaccatcaacctgacgacgcggctgtcccagttcgacttccag
ctcgaagccgtggacgccgccatccatttcggcctgccgcactggccgggcgccgagctg
gcctttctgatgagcgagaccgtggtgcctgcctgcagccccgccctgctggcccagcat
ggctttgcccagccccaggacctgctgcaggcgccgctgctgcacctggcctcgcgcccc
gatgcctggcagcgctggctgtccgtgcaccatgcgcccatggccgagggccagggcatg
ctgttcgaccagttcgccaccgccgcccaggccgccatcgccggcgtgggcgtggccttg
ctgccacgctttctgatcgagcgcgaactcgcccagggcgacctggtgcgtgccctgccc
catctgcccgagatggaaagcgccgagcgctactacctggcctggcccacgagccgcggc
aactacccgccgctgcaaagcctgcgcgagtggctgcagcaggcagcccaggatttcatg
cgggacggcccgcagccctga

DBGET integrated database retrieval system