KEGG   Delftia acidovorans: Daci_5668Help
Entry
Daci_5668         CDS       T00620                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
dac  Delftia acidovorans
Pathway
dac02024  Quorum sensing
Module
dac_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daci_5668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5668
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Daci_5668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_16 AAA AAA_25 Mg_chelatase AAA_5 IstB_IS21 ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ABX38296
UniProt: A9BXM0
Position
complement(6304364..6305392)
Genome map
AA seq 342 aa AA seqDB search
MDTDTLLLQVSGLRVAFQGRRGQATVLNGVDFDLRAGETLCVVGESGCGKSMTALALLRL
IPSPPGRITGGQVRFQGEDLVAAGEAHMRQVRGNRISMIFQEPMTSLNPVLTVGEQIAEP
LRLHAGLDAGAARQRAVEMLRQVGIPAPERRVHEYPHQLSGGMRQRVMIAMALACRPDIL
IADEPTTALDVTVQAQIFDLLRELQRDKGTAIVLITHDMGAVAEMADRVMVMYAGRVIEQ
GRCEQVLSAPAHPYTRGLIACLPELGSSQAGGRTELPEIPGVVPSIWELGSGCAFRARCR
EAQPRCASEAPPLVALDDPSHGVACWLHAPATRIRAHTEALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgacaccctcctgttgcaagtgagcggcctgcgcgtggccttccagggccgg
cgcggccaggccacggtgctcaacggcgtggatttcgatctgcgcgcgggcgagaccctg
tgcgtggtcggcgaatccggctgcggcaagagcatgacggcgctggcgctgctgcgcctc
attccctcgcctccgggccgcatcacgggcgggcaggtgcgcttccagggcgaggacctg
gtggccgccggcgaggcccatatgcgccaggtgcgcggcaaccgcatctccatgatcttc
caggagccgatgacctcgctgaacccggtgctcaccgtgggcgagcagatcgccgagccg
ctgcgcctgcacgccggcctggatgcgggcgccgcgcgccaacgcgccgtggaaatgctc
cggcaggtcggcatccccgcgcccgagcggcgcgtgcacgagtacccgcaccagctgtcg
ggcggcatgcgccagcgcgtgatgatcgccatggccctggcctgccggcccgacatcctg
atcgccgacgagcccaccacggcgctggacgtgaccgtgcaggcgcagatcttcgacctg
ctgcgcgagctgcagcgcgacaagggcacggccatcgtgctgatcacgcacgacatgggg
gccgtggccgagatggccgaccgcgtcatggtcatgtatgcgggccgcgtgatcgagcag
ggccgctgcgagcaggtgctgtcggcgcccgcccacccctacacgcgcggcctgatcgcc
tgcctgccggagctgggcagcagccaggcaggcgggcgcaccgagctgccggaaatcccg
ggcgtcgtgccctcgatctgggagctgggcagcggctgcgcctttcgtgcgcgctgccgc
gaggcccagccgcgctgcgccagcgaggcaccaccgctggtcgcgctggatgatccatcc
cacggcgtggcctgctggctgcacgctcccgctacccgcatccgcgcccacacggaggcc
ctggcatga

DBGET integrated database retrieval system