KEGG   Delftia acidovorans: Daci_5678Help
Entry
Daci_5678         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, TetR family
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dac03000]
    Daci_5678
Transcription factors [BR:dac03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    Daci_5678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: ABX38306
UniProt: A9BXN0
Position
6316973..6317575
Genome map
AA seq 200 aa AA seqDB search
MKVTKAQAAQNRQDILEAAARLYREHGLDGVGVAEVTRGAGLTHGGLYRHFESKDALVRE
ACARAFDWSIAPLDGLQGEQAGSLAARVQSYLSPQHRDSPGEGCPAAALAVDVARAGGDL
SAVFAEGVERNIGRFARVIGTLGDDQAPDATQRAQAMAMLSSMVGALVLARATVAANPAL
SDEILKTVQAHLLAPESQAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcacgaaagcccaggccgcgcagaaccggcaggacatcctcgaagccgccgcg
cggctgtaccgcgagcacgggctggacggcgtcggcgtggccgaggtgacgcgcggcgcg
gggctcacgcacggcgggctctatcgccacttcgaatccaaggacgcgctggtgcgcgag
gcctgcgcacgcgccttcgactggtccatcgcgccgctggacggcctgcagggtgaacag
gccggcagtcttgccgcgcgcgtgcagtcctatctgtcgccacagcaccgcgacagcccc
ggcgagggctgccccgctgcggcgctggccgtggacgtggcccgggcaggcggcgatctt
tcagcggtgttcgccgaaggggtggaacgcaacatcggcagatttgcgcgcgtgataggc
acacttggcgacgatcaggcacccgatgccacacagcgcgcccaggccatggccatgctc
agcagcatggtgggcgccctggtcctggcacgcgccacggtcgcggccaatccagccttg
tccgacgagattctgaaaacggtgcaggcccaccttcttgcgcccgagagccaggcccgt
tga

DBGET integrated database retrieval system