KEGG   Delftia acidovorans: Daci_5684Help
Entry
Daci_5684         CDS       T00620                                 

Definition
(GenBank) OsmC family protein
  KO
K07397  putative redox protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Daci_5684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-ProteinID: ABX38312
UniProt: A9BXN6
Position
complement(6322395..6322847)
Genome map
AA seq 150 aa AA seqDB search
MECTVSWTGGTTGMRSGMGFVAETGSGHVVNMDGAPDAANPANGGQNQAPRPMEMLLAGA
GGCTAYDVVLILKRGRHAVKGCSVKLTSERADADPKVFTKIHMQFTVSGTGLPTGAVERA
IAMSHDKYCSATIMLGKTAEITTGFDIVEA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcacagtgagttggacaggcggcacgaccggcatgcgctcgggcatgggcttc
gtggcggaaacgggcagcggccacgtggtcaatatggatggggcgccggatgcggccaac
cccgccaacggagggcagaaccaggcaccccgccccatggagatgctgctggccggcgcc
ggtggctgcacggcctatgacgtggtgctgatcctcaagcgcggcaggcatgccgtcaaa
ggctgcagcgtcaagctcacctcggagcgcgcagacgcggaccccaaggtgttcaccaag
atccacatgcagttcaccgtcagcggcacgggcctgcccacgggtgcggtggaacgtgcc
atcgccatgagccatgacaaatactgctcggccaccatcatgctgggcaagacggccgag
atcaccacgggattcgacatcgtcgaggcctga

DBGET integrated database retrieval system