KEGG   Delftia acidovorans: Daci_5692Help
Entry
Daci_5692         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02459  general secretion pathway protein J
Organism
dac  Delftia acidovorans
Pathway
dac03070  Bacterial secretion system
Module
dac_M00331  Type II general secretion pathway
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_5692
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5692
Secretion system [BR:dac02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   Daci_5692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl
Motif
Other DBs
NCBI-ProteinID: ABX38320
UniProt: A9BXP4
Position
6328129..6328830
Genome map
AA seq 233 aa AA seqDB search
MRHPSRTHGFTLVELMVAIAVMALLALVSWRGLDSMVRSQESIRARNEQQMVLQTVIAQW
NADLEALMPLENTQVIDWDGQVLRMTRKSSAAVDDGAVVVAWARRQTAGRDQWLRWQSPP
LRTRAQWRDAWNQGSQWGRNPSDDQRRRETVLMPLDQWRLYYYRDNAWSNPQSSGSDNGT
GTVNPPSGGTNSSAQLPTIPDGIRVELTLPPDSAIPGRVTMDWVNPLRSNSRS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccacccctcccgcacgcacggcttcaccctggtggagctgatggtggccatcgcc
gtcatggccctgctggccctggtgagctggcgcggactggacagcatggtgcgctcgcag
gagagcattcgtgcccgcaacgagcagcagatggtgctgcagaccgtcatcgcccaatgg
aatgccgacctcgaagcgctgatgccgcttgaaaacacgcaggtcatcgactgggacggc
caggtgctgcgcatgacccgcaagagcagcgccgccgtggacgacggcgccgtggtcgtc
gcctgggcgcgccgccagacggcagggcgcgaccagtggctgcgctggcagtcgccgccg
ctgcgcacgcgcgcacagtggcgcgatgcctggaaccagggatcgcaatgggggcgcaac
ccctcggacgaccagcgccggcgcgaaaccgtgctgatgcccctggaccaatggcgcctg
tactactaccgcgacaacgcctggagcaatccgcagtccagcggctcggacaacggcacg
ggcacggtcaacccgccgtccggcggcaccaacagcagcgcgcagctgcccacgattccc
gacggcatccgcgtcgaactgaccctgccgcccgacagcgccattcctggccgcgtcacc
atggactgggtcaaccccttgcgctccaacagccgatcatga

DBGET integrated database retrieval system