KEGG   Delftia acidovorans: Daci_5693Help
Entry
Daci_5693         CDS       T00620                                 

Definition
(GenBank) General secretion pathway protein K
  KO
K02460  general secretion pathway protein K
Organism
dac  Delftia acidovorans
Pathway
dac03070  Bacterial secretion system
Module
dac_M00331  Type II general secretion pathway
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_5693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5693
Secretion system [BR:dac02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   Daci_5693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSK HHH_3 MarR_2
Motif
Other DBs
NCBI-ProteinID: ABX38321
UniProt: A9BXP5
Position
6328827..6329804
Genome map
AA seq 325 aa AA seqDB search
MMRTPRLLPGRRLHRGVALLAAMLTVTLVATFAATALWQQWRSVEVETAERNRMQAAWIL
LGALDWSRVVLAEDARTSLQVDHLAEPWAVPLQEARLSTFLAAQNNVSQVDDGMADMQDA
FLSGQIIDLQSRLNLRNLLSAPDKPETLRPLSRLLERLNLPPAYATQIVQALRAAATPGE
GAQFLMPRTLRQFGWLGLPPEVVARLEPYITLLPENTPVNLNTASAEVIWASVEDLTWSQ
ASQLVQLRASRPLRSLADASNALGLPQKFEGQNLSVATSFFEARGRMRLGEIVASERSML
RRNNMTVTTIWRERGDWGLPEAPAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcacaccccgcctcctgcccggccgccgcctccaccgtggcgtggccctgctg
gccgccatgctcacggtgaccctggtggcaacgttcgccgccaccgcgctgtggcagcag
tggcgcagcgtggaggtcgagaccgccgagcgcaaccgcatgcaggccgcctggatcctg
ctgggtgcgctggactggtcgcgcgtggtgctggccgaggatgcgcgcaccagcctgcag
gtggaccatctggccgaaccctgggccgtgccgctgcaggaggcgcgcctgtccacgttt
cttgcggcgcagaacaatgtcagccaggtcgatgacggcatggccgacatgcaggacgcc
tttctctcgggccagatcatcgacctgcagtcgcgcctgaacctgcgcaacctgctgagc
gcccccgacaagcccgaaaccctgcgcccgctgtcccgcctgctggagcgcctgaacctg
ccccctgcctatgccacgcagatcgtccaggccctgcgcgcagccgccacccctggcgag
ggcgcgcagttcctgatgccgcgcacgctgcgccagttcggctggctgggcctgccgccc
gaggtcgtcgcgcgcctggagccctacatcaccctgctgcccgagaacacgcccgtcaac
ctcaacaccgccagcgccgaagtcatctgggccagcgtggaggacctgacctggtcccag
gccagccagctggtgcagctgcgcgcatcgcgcccgctgcgcagcctggccgatgcctcc
aacgcgctgggcctgccgcagaaattcgaaggacagaacctgtcggtggccaccagcttc
ttcgaggcgcgtggccgcatgcgcctgggcgagatcgtggccagcgaacgctccatgttg
cgtcgcaacaacatgacagtcactaccatctggcgtgagaggggggactggggattgccc
gaagctcccgcgccatga

DBGET integrated database retrieval system