KEGG   Delftia acidovorans: Daci_5694Help
Entry
Daci_5694         CDS       T00620                                 

Definition
(GenBank) General secretion pathway L
  KO
K02461  general secretion pathway protein L
Organism
dac  Delftia acidovorans
Pathway
dac03070  Bacterial secretion system
Module
dac_M00331  Type II general secretion pathway
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_5694
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5694
Secretion system [BR:dac02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   Daci_5694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GspL_C T2SSL Lectin_N
Motif
Other DBs
NCBI-ProteinID: ABX38322
UniProt: A9BXP6
Position
6329801..6331093
Genome map
AA seq 430 aa AA seqDB search
MTDGCHTRPLQCPLPPMSTLILHLPAGPAGEYAYALSSDGLRADRHGHAAAGLLPDPGRT
GQTVAVVPHQALSWHLVSLPHGVPTGSRRGHVRLRAVLDGLLEERLLDEPSQLHLALQPQ
ARAGEPCWVAACNKAWLHAHLQALESAGRPVGRIVPECPPQATPQLWAVGSPESAWLLAT
GLSTAAQGMDSLACLPLRTDSADPAMLAALLQALPPDTPIQADPALARAAEALQRPVSLL
TDAQRGLAARAQSWDLAQFDLDLGGGSRTRRRMLDGWQSFLRAPQWKAARWGAVLALLAQ
VVGINAWAWTENRAIAAKQVQVRSTLATSFPRVPVIVDAPVQMQREVATLRQTAGALTQG
DLEPLLAAASRALPAGQLPQAMDYQDRQLRLKGVSLEAEALEQAQQHLAGSGLRLQRDGA
DLLLAQEARP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacagatggctgtcacactcgccccctacaatgcccgcttccgcccatgagcaccttg
attcttcatctgcctgcgggccccgctggcgaatacgcctacgcactcagcagtgacggc
ctgcgcgccgaccggcatggccacgccgccgcaggcctgctgcccgatcctggccgcacc
ggccagacggttgccgtggtgccgcaccaggccttgtcctggcatctggtcagcctcccc
catggcgtgcctacgggtagccggcgcggacatgtgcgcctgcgcgccgtgctcgacggg
ctgctggaagagcgcctgctcgacgagccctcccaattgcacctggccctgcagccgcag
gcacgcgcaggcgagccctgctgggttgccgcctgcaacaaggcttggctccatgcccac
ctgcaggccctggaatccgcagggcggcccgtgggccgcatcgtgccggaatgtccgccc
caggccacgccccagctctgggccgtgggctcacccgaatcggcctggctgctggccacc
ggcctgagcaccgccgcgcagggcatggactcgctggcctgcctgccgctgcgcaccgac
agtgccgacccggccatgctggccgccctgcttcaggccctgccccccgacaccccgatc
caggccgacccggcgctggcccgcgccgccgaggccctgcagcgccccgtcagcctgctg
acggacgcccagcgcggcctggcggcccgcgcacaaagctgggatctggcccagttcgac
ctggatctgggcggcggcagccgcacacggcggcgcatgctcgacggctggcaaagcttt
ttgcgcgcgccgcaatggaaggccgcgcgctggggcgccgtgctcgccctgctggcccag
gtagtgggcatcaatgcctgggcctggaccgagaaccgcgccattgcggccaagcaggtc
caggtgcgctccacgctggccaccagctttccccgcgtgcccgtcatcgtcgacgcgccc
gttcaaatgcagcgcgaagtcgccacgctgcgccagaccgccggcgcgctgactcagggc
gacctggagcccctgctggccgccgcatcccgggccctgcccgctggacagttgccccag
gccatggactatcaggaccggcagctgcgcctcaagggcgtctcgctggaggccgaggca
ctggagcaggcacaacaacacctggccggcagcggcctgcgactgcagcgcgacggcgcc
gacctgctgcttgcccaggaggcccggccatga

DBGET integrated database retrieval system