KEGG   Delftia acidovorans: Daci_5700Help
Entry
Daci_5700         CDS       T00620                                 

Definition
(GenBank) luciferase family protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ABX38328
UniProt: A9BXQ2
Position
6336633..6337634
Genome map
AA seq 333 aa AA seqDB search
MTSFNEVRLSMLDLVAVREGGTVAEALDIALATARKAEELGFERYWLAEHHNMPGIASSA
TAVLIGHIAGGTSKIRVGSGGIMLPNHAPLVVAEAFGTLAELYPGRIDLGLGRAPGTDGA
TMRALRRDRVETEEDFPRDVMELQRLLGPATPEQKLVATPGAGTNVPIWLLGSSLFSAQL
AAHLGLPYAFASHFAPRMLYQAVQLYRSLFKPSAQLAKPYVIVGAPVIAAPTDDEAEYLA
SSTYQRVLGIITGRRGLLPRPIENYAAQLGEQERRAIGDFLAVASIGGPDKVRTRLQKLQ
ADTEADELILVSDVYDRDLRLRSLEITAGVMGR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattcaatgaagtccgtctgtccatgctcgacctcgtggccgtgcgcgaaggc
ggcaccgtcgccgaggccctggacattgcgctggccacggcccgcaaggccgaagaactg
ggattcgagcgctactggctcgccgagcaccacaacatgcccggcatcgccagctcggcc
acggccgtgctgatcggccatatcgcaggcggcacctcgaagatccgcgtgggctcgggc
ggcatcatgctgcccaaccatgcccccctggtggtcgccgaagccttcggcacgctggcc
gagctgtacccgggccgcatcgacctgggcctgggccgcgcgcccggcaccgatggcgcc
accatgcgcgccctgcgccgcgaccgcgtcgagaccgaggaagacttcccgcgcgacgtg
atggagctgcagcgcctgctgggcccggccacgcccgagcaaaagctggtggccacgcct
ggcgcgggcaccaacgtgccgatctggctgctgggctccagcctgttctcggcccagctg
gccgcccacctgggcctgccctacgcctttgcctcgcactttgcgccgcgcatgctctac
caggctgtgcagctgtaccgcagcctgttcaagccgtcggcccaactggccaagccctac
gtgatcgtcggcgcccccgtgatcgccgcgcccaccgatgacgaggccgagtacctggcc
agcagtacctaccagcgcgtgctgggcatcatcacgggccggcgcggactgctgccgcgc
cccatcgagaactatgcggcccagctcggcgagcaggagcgccgcgccatcggcgacttc
ctggccgtggcctccatcggcggcccggacaaggtgcgcacgcgcctgcaaaagctgcag
gccgacaccgaggccgacgagctgatcctggtcagcgacgtgtatgaccgcgacctgcgc
ctgcgctcgctggagatcacggccggcgtcatgggccgctga

DBGET integrated database retrieval system