KEGG   Delftia acidovorans: Daci_5703Help
Entry
Daci_5703         CDS       T00620                                 

Definition
(GenBank) general secretion pathway protein F
  KO
K02455  general secretion pathway protein F
Organism
dac  Delftia acidovorans
Pathway
dac03070  Bacterial secretion system
Module
dac_M00331  Type II general secretion pathway
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_5703
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5703
Secretion system [BR:dac02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   Daci_5703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF DUF996
Motif
Other DBs
NCBI-ProteinID: ABX38331
UniProt: A9BXQ5
Position
6339206..6340432
Genome map
AA seq 408 aa AA seqDB search
MPAFSFEALDAQGQTRKGTIEADNARAARSQLRAQALVPMAVEIVASGSASGPQGGASRW
LTRPVLGSTGLTVWTRQMAGLVGSGLPIERALAALSEEADDPRQHHLVAALRAEVNAGST
FARALAQHPREFSDIYCAVIGAGEASGSLGPVLERLADDLESRQALQSKLIGAALYPAIV
TLVAIVIVLFLVSYVVPQVASVFAGTKRALPWLTVAMLALSDFVRSYGWAALVALVLGAV
GFRLSMKNPALRERFDAWWLRLPLIGRLARNYNAARFAGTLAMLAGAGVPILKALQAAAE
TLGNRALRADAMDALALVREGAPLASALAQKKRFPGLISMFARLGEQTGQLPVMLQRAAN
QLSTEVQRRAMHLATILEPLLIVAMGMVVALIVLAVLMPIIQLNQFVK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttttccttcgaagccctggatgcacaaggtcagacccgcaagggcacgatc
gaagccgacaacgcgcgcgccgcgcgcagccagctgcgggcccaggccctggtgcccatg
gccgtggagatcgtggcctcgggttccgcgtccggcccgcagggcggcgcctcgcgctgg
ctgacccgccccgtccttggctccacagggctcaccgtgtggacgcgccagatggcgggg
ctggtcgggtcaggcctgcccatagagcgcgccctggccgccctgtccgaagaagccgac
gacccgcgccagcaccacctcgtggccgcgctgcgcgccgaggtcaacgcaggctccacc
tttgcccgcgccctggcccagcacccgcgcgagttctccgacatctactgcgccgtgatc
ggcgccggcgaggccagcggcagcctgggcccggtgctggagcggctggccgacgacctg
gaatcgcgccaggccctgcagtccaagcttatcggcgcagccctgtacccggccatcgtg
accctggtggccatcgtcatcgtgctgttcctggtcagctacgtggtgccccaggtggcc
agcgtgttcgccggcaccaagcgcgccctgccctggctcaccgtggccatgctggcgctc
agcgacttcgtgcgcagctatggctgggccgcactggtcgccctggtgctgggcgccgtg
ggattccggctgtccatgaagaaccccgcgctgcgcgagcgcttcgacgcttggtggctg
cgcctgccgctgatcggccggctggcgcgcaactacaacgcggcacgctttgccggcacg
ctggccatgctggcgggcgcaggcgtgcccattctcaaggccttgcaggccgcagccgaa
acgctgggcaaccgcgcgctgcgtgccgacgccatggacgcgctggccctggtgcgcgag
ggcgcgccgctggcctcggcgctggcgcagaaaaagcgcttcccgggcctgatctccatg
tttgcccgcctgggcgagcagaccggccagttgcccgtgatgctgcagcgcgcggccaac
cagctgtccaccgaggtgcagcgccgcgccatgcacctggccaccatcctggagccgctg
ctgatcgtggccatgggcatggtcgtggccctgatcgtgctggccgtgctcatgcccatc
atccagctcaaccagttcgtcaaatag

DBGET integrated database retrieval system