KEGG   Delftia acidovorans: Daci_5704Help
Entry
Daci_5704         CDS       T00620                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
dac  Delftia acidovorans
Pathway
dac00230  Purine metabolism
dac00240  Pyrimidine metabolism
dac00760  Nicotinate and nicotinamide metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Daci_5704
   00240 Pyrimidine metabolism
    Daci_5704
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Daci_5704
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Daci_5704
CD molecules [BR:dac04090]
 Proteins
  Daci_5704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-ProteinID: ABX38332
UniProt: A9BXQ6
Position
6340449..6341369
Genome map
AA seq 306 aa AA seqDB search
MPVTLQDKLVVAISSRALFDFEEENRLFDAGDEQAYMRRQLDLVHQPARPGIAFPLVRKL
LAFNTPEVQRVEVMMLSRNDPASGMRVFASAKAADMHIERGVFTRGRDPFSYLRPLGAHL
FLSANEVDVRRALSIGFPAARVMVDSTPAGDRYPQEVRIAFDGDAVLFSDEAERVYQQGG
LPAFLRHEVSHAATPLAEGPFKPLLVALHRLQQQADSSQTMRIRTALVTARSAPAHERAI
RTLLEWGIAVDEAMFLGGLEKGPFLREFEPDFFFDDQTGHVNSAARHVPAGHVSSGISNP
DADPPK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgaccctgcaagacaagctggtcgtcgccatctcctcgcgggcgctgttcgat
ttcgaggaggagaaccggctgttcgacgccggtgacgagcaggcctacatgcgccgccag
ctggacctggtgcaccagcccgcacgcccgggcatcgccttcccgctggtgcgcaagctg
ctggccttcaatacgcccgaagtgcagcgcgtggaggtgatgatgctgtcgcgcaacgac
ccggccagcggcatgcgggtcttcgcctctgccaaggcggccgacatgcacatagagcgc
ggcgtgttcacgcgcgggcgcgatccgttttcctacctgcggccgctgggcgcccacctg
tttctctcggccaacgaggtcgatgtgcgcagggcgctgtccatcggctttcctgccgcg
cgcgtgatggtcgattccacgcccgcaggcgaccgctacccgcaggaggtgcgcattgcc
ttcgacggcgatgccgtgctgttctccgacgaggccgaacgcgtctaccagcaaggcggg
ctgccggcctttttgcgccacgaggtctcccatgccgccacaccgctggcggaagggccg
ttcaagccgctgctggtggcgctgcaccggctgcagcagcaggcggactcgtcccagacc
atgcgcattcgcacggccctggtgacggcgcgcagcgcaccggcgcacgagcgtgccatc
cgcacgctgctggaatggggcattgcggtggacgaggccatgttcctcggcggcctggaa
aagggcccgttcctgcgcgagttcgagccggacttcttcttcgacgaccagaccggccac
gtcaactcggccgcgcgccatgtgccggcaggccacgtgagcagcggcatctccaatccg
gacgccgatccgccgaagtaa

DBGET integrated database retrieval system