KEGG   Delftia acidovorans: Daci_5708Help
Entry
Daci_5708         CDS       T00620                                 

Definition
(GenBank) ABC transporter related
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase AAA_29 AAA_16 AAA DZR PufQ AAA_22 MMR_HSR1 Zeta_toxin zinc_ribbon_2 NB-ARC bPH_3 AAA_15
Motif
Other DBs
NCBI-ProteinID: ABX38336
UniProt: A9BXR0
Position
complement(6343033..6345327)
Genome map
AA seq 764 aa AA seqDB search
MQEHHSVDVSAFLASPRGAGLRARLASNENVLALVPVDLTLDMRFGEGWVVLTNQRLLAC
DPADQQWSEWALSIDQNLRTLDHGGVGNLELHGPAARLALWRFTLRHQAAVLRLLQQFDH
ERERLARGEDFAEPEDDVPRCPACQAELPPEADECPACARQQGPQTSTWVLLRLWRFAHP
YRHQLLLGFLLTLASTGATLVAPYLTIPIVDKILIPFQNGQQIDSSLVVFYLSGLLAAAL
VAWGLGWARTFVLAKVSERIGSDLRTTTYNHLLTLSLDYYGSKRTGDLMARIGAETDRIN
LFLSLNALDFATDVLMIVMTSVILFSINPWLALVTLVPLPFIAWMIHLVRDRLRTGFEKI
DRVWSEVTNVLADTIPGIRVVKAFAQEKREADRFAQANLVNLQANDKVNKTWSLFTPTVT
LLTEIGLLVVWGFGIWLVAGGQITVGILTAFIAYIGRFYSRLDSMSRIVSVTQKAAAGAK
RIFDILDHVSNVPDPVNPVKLPRVQGAITLDNLTFRYGSRAVIKNLDLQIRPGEMIGLVG
HSGSGKSTLVNLISRFYDVSEGSIQLDGVDIRRLKVSDFRSNIGLVLQEPFLFFGTIAEN
IAYGKPDATREEIVAAARAAHAHEFILRLPHGYDSLVGERGQGLSGGERQRISIARALLI
DPRILILDEATSAVDTETEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGEIV
EVGPHDELMEKQGAYWRLYQAQARRAEEDAQAAGLTLAATTIEE
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacaccattctgtggacgtttcggccttccttgccagcccccgcggggctggg
ctgcgagccaggctcgcttccaatgaaaacgtgctggccctcgtcccggttgacctgacc
ctcgatatgcgcttcggcgaaggctgggttgtgctgaccaaccagcggctcctcgcctgt
gatcctgcagatcagcagtggagtgagtgggcactatccattgatcagaatctgcgcacg
ctggaccacggcggcgtgggcaacctcgaactgcacggccctgcggcgcggctggcgctg
tggcgcttcacgctgcgccaccaggcggccgtgctgcgcctgctgcagcagttcgaccat
gagcgcgagcgcctggcacgcggcgaggacttcgccgagcccgaggacgacgtgccccgc
tgcccggcctgccaggccgagctgccgcccgaggccgacgaatgcccggcctgcgcgcgc
cagcagggcccgcagacctccacctgggtgctgctgcgcctgtggcgctttgcccatccc
taccggcaccagctgctgctgggctttctgctgacgctggcctccacgggcgccaccctg
gtggcgccctacctgacgattcccatcgtggacaagatcctgatcccgttccagaacggg
cagcagatcgacagcagcctcgtggtcttctacctgagcgggctgcttgcggcggcgctg
gtggcctggggcctgggctgggcgcgcaccttcgtgctggccaaggtctccgagcgcatt
ggctcggacttgcgcaccaccacttacaaccacctgctgacgctgtcgctggactactac
ggcagcaagcgcacgggcgacctgatggcgcgcatcggggcggaaacagatcgcatcaat
ctgtttctatccttgaatgcgctggatttcgccaccgacgtgctgatgatcgtgatgacc
tcggtcatcctgttctccatcaatccgtggctggccctggtcaccctggtgccgctgccc
ttcatcgcctggatgatccatctggtgcgcgaccgcctgcgcacgggcttcgagaagatc
gaccgcgtctggtccgaagtgaccaatgtgctggccgacaccatccccggcatccgcgtg
gtcaaggccttcgcccaggaaaagcgcgaggccgaccgcttcgcccaggccaacctggtc
aacctgcaggccaacgacaaggtcaacaagacctggtcgctgttcacgcccacggtgacg
ctgctgaccgagatcggcctgctcgtggtctggggcttcggcatctggctggtggctggc
ggccagatcacggtcggtatcctgacggccttcatcgcctacatcggccgcttctacagc
cgcctggactcgatgagccgcatcgtctcggtcacgcagaaggcggcggccggcgccaaa
cgcatcttcgacatcctcgaccacgtgagcaacgtgcctgacccggtcaacccggtcaag
ctgccgcgcgtgcagggcgccatcacgctggacaacctgaccttccgctacggcagccgc
gccgtgatcaagaacctggatctgcagattcgtccgggtgaaatgatcggtctggtcggc
cacagcggctcgggcaagagcaccctggtcaacctgatcagccgtttctatgacgtgagc
gagggctccatccagctcgacggcgtggacatccgcaggctcaaggtgtcggacttccgc
agcaacatcggcctggtgctgcaggagcccttcctgttcttcggcaccattgccgagaac
atcgcctacggcaagcccgatgccacgcgcgaggaaatcgtggcggcggcccgcgctgcc
cacgcccatgaattcatcctgcgcctgccgcatggctacgactccctggtgggcgagcgc
ggccagggcctgtcgggcggcgagcgccagcgcatctccattgcacgcgcactgctgatc
gacccgcgcatcctgatcctggacgaggccacctcggccgtggacaccgagaccgagaag
gaaatccagaaggcgctggacaacctggtgcagggccgcacgacgattgccattgcccac
cgcctgtccacgctgcgcaaggccgaccgcctcgtggtcatggaccggggcgagatcgtg
gaagtgggtccgcacgacgagctgatggaaaagcagggcgcctactggcgcctgtaccag
gcccaggcgcggcgcgccgaagaggatgcccaggccgcaggcctgaccctggccgcaacc
accatcgaggaataa

DBGET integrated database retrieval system