KEGG   Delftia acidovorans: Daci_5711Help
Entry
Daci_5711         CDS       T00620                                 

Definition
(GenBank) CreA family protein
  KO
K05805  CreA protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Daci_5711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CreA
Motif
Other DBs
NCBI-ProteinID: ABX38339
UniProt: A9BXR3
Position
6350501..6351010
Genome map
AA seq 169 aa AA seqDB search
MIKPSVKYFPRGRALLTAALATLLLGACGARAEQVGAVDTVFKFIGPDHKIVVDAYDDPK
VAGVTCYVSRAKTGGIKGGLGLAEDRAEASISCVQTGPIQIPAPLKQQDEVFTERISLLF
KRLRVVRMVDAQRNTLVYMTYSDRVIEGSPQNSVTAVPVPRSTPIPLGK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacccagtgtgaagtatttcccgcgaggccgggccttgctcacggccgccctg
gccacgctgctgctgggcgcctgcggtgcgcgcgccgagcaggtcggcgcggtggacacg
gtgttcaagttcataggcccggaccacaagatcgtggtcgatgcctatgacgatcccaag
gtggcgggcgtgacctgctatgtctcgcgcgccaagaccggcggcatcaagggcggcctg
ggcctggccgaggaccgcgccgaagcctcgatcagttgcgtgcagaccggccccatccag
atccctgcgccgctcaagcagcaggacgaggtgttcaccgaacgcatctcgctgctgttc
aagcgcctgcgcgtggtgcgcatggtcgatgcgcagcgcaacaccctggtctacatgacc
tactcggaccgcgtgatcgaaggctcgccgcaaaacagcgtcaccgccgtgcccgtgccg
cgcagcacgccgattccgctgggcaaataa

DBGET integrated database retrieval system