KEGG   Delftia acidovorans: Daci_5718Help
Entry
Daci_5718         CDS       T00620                                 

Definition
(GenBank) peptidase S1 and S6 chymotrypsin/Hap
  KO
K01337  lysyl endopeptidase [EC:3.4.21.50]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dac01002]
    Daci_5718
Enzymes [BR:dac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.50  lysyl endopeptidase
     Daci_5718
Peptidases [BR:dac01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Daci_5718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-ProteinID: ABX38346
UniProt: A9BXS0
Position
6357890..6359971
Genome map
AA seq 693 aa AA seqDB search
MCGAGTALAVSAPGCRCSAATILGSAGRRCRHRAVTHTTPKMPGFRNIHQSVEREPMTDL
FDTTARRGLRSVALALALAGSLGLACGQESAYPAMSVDHHVQPLNSPREFLASRSLAAPS
EVTPLRVELGAWKEYHAASAPQDGAMQVGAQRLSTQTATTDALASQLQWHSTASGGLVAA
VSLRSEGAYGIRMGVEMQQLPGSALLRVYARDHRAGAYEIAGQRVLQGLQANLEAGDKTT
DGRTWWTPDTGGDEVTLEIELPPGIPADALRIAIPRVMHIHENLSLPLESEMQFSAQLNE
SLSCNLDSTCYDNYSTQRNAVARMLYVKNGAGYLCTGTLLNDKAASGTPYFITANHCISS
QTVASTLETSWFYRTPSCNSRTLSSANRVLRNGATLLYATADYDSTLLRLNDAPPAGAVF
AGWTSQTVAGGTSMVGIHHPRGDLQKISFGTVSRSVSCEPSSEGMMKCANVSGGFNLVNW
DQGLTQGGSSGSGMFVEGRLAGVLYGGDDQTCPASGGMSIYGRFDLLFPNVQKWLAADPI
TGTSQTRTPVYRFFNRVTGAHFYTANAQERDQVIATYPAFQYENVAFYASTQMQQGLDPV
FRFFNRNTSAHFFTIDAFERNQVKIYYPGFIDEGVAWYAATTAVNGTVPIFRFFNEQTGA
HFYTINIAERDQVITKYPFFKYEGVGYYVWKTQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggggcaggcacggcgctcgcagtgtccgcacccggctgccgctgcagcgcagcg
accattctaggaagcgccggacggcggtgccgtcaccgggctgtcacgcacacaacacct
aaaatgcccgggtttcgcaatatccaccaatccgttgagagggagcccatgaccgatctt
ttcgacaccactgcgcgcaggggtttgcgcagcgtcgcgctggcgctcgccctggccggc
agcctggggctggcctgcgggcaggaatctgcctaccccgccatgagcgtggaccaccat
gtccagcctctgaactcccctcgggaatttctggcatctcgcagcttggccgccccttcc
gaggtcacaccactgcgcgtggaactgggcgcttggaaggagtaccacgccgcatcggcc
ccgcaggacggcgccatgcaggtgggcgcgcagcgactgagcacacagacggccacgacc
gacgcgctggcctcgcagttgcaatggcactccacggcctcgggcggcctggtggccgct
gtcagcctgcgttcggaaggcgcctacggcatccgcatgggcgtcgagatgcagcaactg
ccaggcagtgcgctgctgcgcgtctatgcgcgtgaccatcgtgcgggcgcctacgagatc
gccggccagcgcgtgctgcagggtctgcaggccaatctggaggcgggagacaaaaccacc
gatggtcgcacctggtggacgccggacaccggcggtgacgaggtgacgctggagatcgaa
ctgccaccaggcattcccgccgacgcgctgcgcatcgccatcccgcgcgtgatgcatatc
cacgagaacctttcgcttccgctggaaagcgaaatgcagttctcggcccagctcaacgag
tccctgtcctgcaatctggactccacctgctacgacaactacagcacacaacgcaatgcc
gtagcacgcatgctctatgtgaagaacggtgcgggctatttgtgcacgggtacgctgctc
aatgacaaggccgcttccggcactccttacttcattacggccaaccattgcatcagcagc
cagacagtggcttccaccctggaaacctcctggttctatcgcacgccctcctgcaacagt
cgcacgttgtcatccgcaaacagggtgctgcgaaacggtgccaccttgctctatgcgacg
gcggactacgattccacactgctgcgcctcaacgatgcgcccccagccggtgcagtgttt
gcaggctggaccagccagacagtggctggtggcaccagcatggtgggcatccaccatccc
cgaggcgatctgcagaaaatcagtttcggcacagtctccagatcagtctcatgcgagcct
tccagcgaagggatgatgaaatgcgccaatgtcagcggtggcttcaacctggtgaactgg
gatcaagggctgacgcaaggaggcagcagcggctcgggcatgttcgtggaaggacgtttg
gccggggtcctctatggcggcgacgaccagacttgccctgcctctggcggcatgtccatc
tatggacgcttcgatctgctgtttcccaatgttcagaaatggcttgcagcagacccgatt
accggcacctcccagacacgtacccccgtctatcgcttcttcaatcgagtcaccggtgcg
catttctacacagccaatgcacaagagcgcgatcaggtgattgcgacctatccggccttc
cagtatgaaaacgtggccttctatgcatccacccaaatgcaacaagggctggatcccgta
ttccgcttcttcaatagaaatacaagcgcgcatttcttcaccatcgacgccttcgagcgc
aaccaggtgaagatctactatcccggcttcatcgatgaaggcgtcgcctggtatgccgcc
acaactgcagtcaatggaacagtccccatattccgcttcttcaacgagcagactggtgcg
cacttctacaccatcaacattgcagagcgggatcaggtgatcaccaagtatcccttcttc
aaatatgagggtgtgggctactacgtctggaaaacccagtaa

DBGET integrated database retrieval system