KEGG   Delftia acidovorans: Daci_5719Help
Entry
Daci_5719         CDS       T00620                                 

Definition
(GenBank) DnaK-related protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3731 HSP70 MreB_Mbl ROK
Motif
Other DBs
NCBI-ProteinID: ABX38347
UniProt: A9BXS1
Position
complement(6360049..6362904)
Genome map
AA seq 951 aa AA seqDB search
MPDTAASESSAPAPASGAAHIVGIDLGTSHTVVAHVPVGGTAADIALLPVAQRVSASEVA
AQVLLPSARYQAAPGELGDAWQQPWTALGADAQAPAVNGRWARDLGAAVPSRLVASAKSW
LSHAGVDRTGAILPWGAPEEVARLSPLQASASYLDHVRQAWDRAHPGAPLRDQLVVLTVP
ASFDEGARALTLEAAQLAGLPAVQLLEEPKAAFHDWLVLQGERLAAELAHCRLVLVVDVG
GGTTDLTLIRVQPGDAGGLPVLTRTAVGEHLMLGGDNMDLALAHRLEPQFAPPGERLPAA
RFAQLVQRCRTAKEQLLANEAPESVAVTLLGGGSKLLAQTRTATLRRDEVREAVVEGFMP
LAGLQDLPTRRQGALRGLGLPYPADAAITRHLAHFLAQHAAGDLPDAVLLNGGVFHAHAL
AQRLVAQLQAWRGQPLRLLHNPHPDWAVARGAAAHGLAMHVQSRPSEDLPESEDARTVPA
PVPRIGGGSPRSYWLVLPEKAGAAPQGICLLPRGTEEGVRIVLSGRRFALRLGQAVRFSL
VANSLAAAPAQAGRIAALDGEGWVELPALSTVLPAPEGRDKAQVEVQLQACMTEVGTLEV
RCVAADDAQRQWLLPFSVRGALAADGQDTGDRSARQGRLADAVALIERIFGSQAQEVTAK
EVRQLRQSLERRLGPREDWDLPLLRALFDALLARSRRRRRTAEHERVWLNLAGWCLRPGV
GAELDGWRMQQVWQLHGQGLGHGGEAANRTEWWVFWRRVAAGLDEARQMELLEEVAGHMQ
KAVQQSTQRSQGKSAHGSYDDMLRLFAAMEAVPWQYRQEMGQWMLQRLKHPGESVQTWWA
IGRLAARMPLAANAHRVMPPEAAQEFLDATLAQDWRRNETAMFAAVQMARMTGDRALDLS
DAQRALVLERLRGAGAPQRWIDLVEQVQQMDAQDAKRSFGDSLPPGLVLVG
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcctgataccgccgcctccgaatcttccgcccccgctcccgcgtccggtgcagcccac
atcgtgggcatcgaccttggcaccagccacaccgtggtggcgcatgtgcccgtgggcggc
acggcggccgacatcgccttgctgcccgtggcgcagcgcgtctcggccagcgaggtcgcc
gcccaggtgctgctgccctcggcgcgctaccaggcggcgcccggcgagctgggcgatgcc
tggcagcagccttggactgctctgggcgccgatgcgcaagcgcccgccgtcaatggccgc
tgggcgcgtgatctgggcgcggccgtgccgtcgcgcctggtggccagcgccaaaagctgg
ctctcgcatgcgggcgtggaccgcacgggggccatcctgccctggggcgcgcccgaagag
gtggcccggctgtcgccgctgcaggcctcggccagctacctggaccatgtgcgccaggcc
tgggaccgcgcccaccccggcgcgccgctgcgggaccagctggtcgtgctgaccgtgccg
gcctcgttcgacgaaggcgcgcgcgcactgacgctggaggccgcgcagctggccggcctg
ccagcggtgcaattgctggaggaacccaaggccgccttccacgactggctggtgctgcag
ggcgaacgcctggcggccgagctggcgcactgccgcctggtgctggtggtggatgtgggc
ggcggcaccaccgacctgaccctgatccgcgtgcagcccggtgacgctggaggcctgccc
gtgctgacacgcacggccgtgggcgagcacctgatgctgggcggcgacaacatggacctg
gcgctggcccatcggctggagccgcaattcgccccgcccggcgagcgcctgcccgccgca
cgcttcgcccaactggtgcagcgctgccgcacggccaaggaacagttgctggccaacgag
gcgcccgagtccgtggccgtgaccctgctgggcggcggatcgaagctgctggcgcagacg
cgcacggccacgctgcgccgcgacgaggtgcgcgaggccgtggtcgaaggcttcatgccg
ctggccggcctgcaggatctgcccacccggcgccagggcgccttgcgcggcctggggctt
ccctatccggccgatgcggcgatcacacggcacctggcgcatttcctcgcgcagcacgcg
gctggggatttgcccgatgcggtcctgctcaacggcggcgtcttccacgcccatgcgctg
gcccagcggctggtggcgcaactgcaggcctggcgcggccagccgctgcgcctgctgcac
aacccgcatcccgactgggccgtggcacgcggcgcagcggcgcatggcctggccatgcat
gtccagagccgtccgtctgaggatctgccggaatcggaagatgcccggactgtgcccgcc
ccggtaccgcgcatcggcggcggctcgccgcgcagctactggctggtcctgcccgagaag
gcgggtgccgcaccacagggcatctgcctgctgccgcgcggcacggaagagggcgtgcgc
atcgtgctctccggccggcgctttgcgctgcgcctgggacaggccgtgcgcttttccctg
gtggccaacagcctggcggcggcgcctgcgcaggccggccgcatcgcggcgctcgacggc
gaaggctgggtcgagctgcccgccctgtccaccgtgctgcctgcgcccgagggccgggac
aaggcccaggtcgaggtgcaactgcaggcctgcatgaccgaggtcggcacgctggaggtg
cgctgcgtggccgccgacgatgcgcagcgccagtggctgctgccgttcagcgtgcgcggt
gcgctggccgcagatgggcaggacaccggcgatcgttctgcccggcagggccggctggcc
gacgccgtggccctgatcgagcgcatcttcggcagccaggcccaggaggtgacggccaag
gaggtccgccagctgcgccagtcgctggagcgacggctgggcccgcgcgaggactgggac
ctgccgctgctgcgcgcactgttcgacgccttgctggcccgctccaggcgccgccgccgc
acggccgagcacgagcgcgtctggctgaacctggcaggctggtgcctgcgccccggcgtg
ggcgccgagctggacggctggcgcatgcagcaggtctggcaactgcatggccagggcctg
ggccatggcggcgaggcggccaaccgcaccgaatggtgggtgttctggcgccgcgtggcc
gcgggcctggacgaggcccggcagatggaactgctggaagaggttgccggccacatgcaa
aaggccgtgcagcagtccacgcagcgcagccagggcaagtccgcccatggcagctacgac
gacatgctgcgcctgttcgccgccatggaggccgtgccctggcagtaccgccaggaaatg
ggccagtggatgctgcagcggctgaagcaccctggtgaatccgtgcagacctggtgggcc
ataggccgcctggccgcgcgcatgccgctggccgccaacgcccaccgcgtgatgccgccc
gaggctgcgcaggagttcctggacgccaccctggcccaggactggcgccgcaatgaaacc
gccatgttcgctgccgtgcagatggcccgcatgacgggcgaccgtgcgctggacctgtcc
gatgcccagcgcgccctggtgctggagcggttgcgcggcgccggtgcaccgcagcgctgg
atcgacctggtggaacaggtccagcagatggacgcccaggatgcgaagcgcagctttggg
gatagcctgccgcctgggctggtgctggtggggtga

DBGET integrated database retrieval system