KEGG   Delftia acidovorans: Daci_5722Help
Entry
Daci_5722         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FapA Bactofilin
Motif
Other DBs
NCBI-ProteinID: ABX38350
UniProt: A9BXS4
Position
6366017..6366892
Genome map
AA seq 291 aa AA seqDB search
MDMELSQNFLRAKSPCAAGFRWFVRNRHDGNDYQRVLDALVGDGRIEDARWLMNQFGPTD
AVLEVDHLEADALVFAGSVVVHGELRVPGLLAVGRTLQAGAGIHAGRIEAGQDLHSGGAI
FCSGPLQAGGLVKAAWSVDVHEELRAEDVRAGWELRCGADLRLGGGAQAGQDIEVQGAIR
CGKGLRAGGSIRASGLIELGHGLYAGADVEGGSHIEVDWGMRALGDIRAACSIRAGETLH
AEGEIAAGPGYGIYAGMNVQQDAWPSCAWVHAAQRPPALLSGWWEEAAAPA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggacatggaactctcccaaaactttctgcgtgccaaaagcccctgcgcggcgggcttt
cgctggttcgtgcgcaaccgccatgacggcaacgactaccagcgcgtgctcgacgccctg
gtgggcgatggccgcatcgaggacgcgcgctggctcatgaaccagttcggccccaccgac
gccgtgctggaggtcgatcacctggaggccgatgccctggtgttcgcgggcagcgtcgtc
gtgcatggcgagctgcgcgtgcccggcctgctggccgtgggccgcacgctgcaggccggc
gccggcatccacgccggccgcatcgaggccggccaggacctgcacagcggcggcgccatc
ttctgcagcggcccgctgcaggccggcggcctggtcaaggccgcctggagcgtggacgtg
cacgaggaactgcgcgccgaggacgtgcgcgcgggctgggagctgcgctgcggcgccgac
ctgcgcctgggcggaggggcacaggccggccaggacatcgaggtgcagggcgccatccgc
tgcggcaagggcttgcgcgcgggcggcagcatccgcgccagcggcctgatcgagctgggc
cacggcctgtacgctggcgccgacgtggaaggcggcagccacatcgaggtggactggggc
atgcgtgcgctgggcgacatccgcgcggcctgcagcatccgcgcgggcgagaccctgcat
gccgaaggcgagatcgcggccggccccggctatggcatctatgcgggcatgaacgtgcag
caggatgcctggccgtcctgtgcctgggtgcatgcggcgcagcgcccgccggcactgctc
agcgggtggtgggaggaagccgcagcaccggcctga

DBGET integrated database retrieval system