KEGG   Delftia acidovorans: Daci_5723Help
Entry
Daci_5723         CDS       T00620                                 

Definition
(GenBank) riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
dac  Delftia acidovorans
Pathway
dac00740  Riboflavin metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Daci_5723
Enzymes [BR:dac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     Daci_5723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding PRE_C2HC
Motif
Other DBs
NCBI-ProteinID: ABX38351
UniProt: A9BXS5
Position
6366993..6367697
Genome map
AA seq 234 aa AA seqDB search
MFTGIIQAVASIAALRDQNGLRTFTLDFPEGFCQDLAIGASVSTDGVCLTVTEILSPTRA
TFDVMLQSLNITTLGGYAVGGRVNVERAAKDGAEIGGHPLSGHVDFTSPVLEVASSDTNH
RIRFGIPEGFRHYVFAKGYIAINGASLTVSEVDRQAGWFEVWLIPETRRMTVFESKGVGD
LLNVEIDRSTQVVVDTVRETVQQSLGRLQPVLEALLKEKGLSLDDFIDVPKLPG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaccggcatcatccaggccgtggcaagcattgccgcgctgcgcgaccagaacggc
ctgcgcaccttcaccctcgactttcccgaaggcttctgccaggacctggccatcggcgcc
agcgtctccaccgacggcgtgtgcctgacggtgaccgagatcctctcgcccacgcgcgcc
accttcgacgtgatgctgcaaagcctgaacatcaccacgctgggcggctatgccgtgggc
gggcgcgtcaatgtggagcgcgcggcaaaggatggcgccgagatcggcggccacccgctg
tcgggccatgtggatttcacctcgcccgtgctggaagtggcctccagcgacaccaaccac
cgcatccgcttcggcattccggagggctttcggcactacgtgttcgccaagggctacatc
gccatcaacggcgccagcctcacggtgtccgaggtggaccgccaggcgggctggttcgag
gtctggctgatccccgagacgcgccgcatgaccgtgttcgagtccaagggcgtgggcgac
ctgctcaatgtggagatcgaccgcagcacccaggtcgtggtggacacggtgcgcgagacc
gtgcagcaaagcctgggccgcctgcagcccgtgctcgaggccctgctgaaagaaaagggc
ctgagcctggacgacttcatagacgtccccaagctgcccggctga

DBGET integrated database retrieval system