KEGG   Delftia acidovorans: Daci_5737Help
Entry
Daci_5737         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4148 CHU_C
Motif
Other DBs
NCBI-ProteinID: ABX38365
UniProt: A9BXT9
Position
complement(6384674..6385033)
Genome map
AA seq 119 aa AA seqDB search
MKHAKTLFAIVSLSSALWSGMASAAPAATVSAETWFGAEPVASGPALSRAEVQADLALWN
RAGLNVYRESDVNHWDADYQQRLAQYQRMRSGPEYLAEVQRLGGSVKAAEGQGSGRVPG
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcaaagaccctcttcgccatcgtttccctttcctccgccttgtggtcgggc
atggcctcggccgcaccggccgccacggtatctgcagaaacctggttcggcgccgagccc
gtcgcctccggccccgcgctgtcgcgcgccgaagtgcaggccgacctggccctgtggaac
cgcgccggcctcaacgtctaccgcgagtccgacgtgaaccactgggatgccgactaccag
cagcgcctggcccagtaccagcgcatgcgcagcggccccgagtacctggccgaagtgcag
cgcctgggtggctcggtgaaggcggccgaaggccagggctccggccgtgtcccgggctga

DBGET integrated database retrieval system