KEGG   Delftia acidovorans: Daci_5738Help
Entry
Daci_5738         CDS       T00620                                 

Definition
(GenBank) adenylate/guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
dac  Delftia acidovorans
Pathway
dac00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Daci_5738
Enzymes [BR:dac01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Daci_5738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc Fer2 Fer2_4
Motif
Other DBs
NCBI-ProteinID: ABX38366
UniProt: A9BXU0
Position
complement(6385184..6386845)
Genome map
AA seq 553 aa AA seqDB search
MARVPHPALPALPSLRSLHWSTGLVLWTYAALHLFNHALGLVSLGTAEAVRELVHGVWRS
LPGSLLLYGALAAHMGLALQALARRRSLRMPALEAVRLLLGLGLPLLLALHVPATRLAQE
AWGVDPSYARIVRSSWNPSSMAIQLLLMTAAWTHGCMGLHMALRARGWWRRWQPLLLTAA
VLLPVLAALGIVSMAREIAAAGLPAPAGPSPEASQWLRALTTGLRQGWLACLAALLAGPW
LWRRMRLRGARQVLLHYPGRTVQVAQGMSVLEASREHGIAHLSLCGGRARCSTCRVRVSG
PAAHLPAPGRDERLTLERVGAPQDVRLACQLRPTGDVQVAPLFRSPAAAQAGRGDGQREV
REVRAVAILFVDLRRWSGLAERQWPVDLSWVLDQYFERVGQAVHDSGGMANQFIGDSVMA
IFGLDTDLDTACRQAVQASALIDRRMQEWSHTFEAQFGQPVDFGMGLHAGRAAVGRVGFE
HTTTFTAVGEVVNTASRLQEYTKSAQARLVLSLEVARRAGVADGLGEVRQVQVRGRSEPL
PALHVARPGLQWP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgtccctcatccggctttgccggctctgccgtccctgcgcagcctccactgg
tccaccggcctggtgctgtggacctatgcggcgctgcacctgttcaatcacgccctgggc
ctggtctcgctgggcacggccgaggccgtgcgcgagctggtccacggcgtgtggcgatcc
ctgcccggcagcctgctgctctacggcgcgctggccgcgcacatggggctggcgctgcag
gcgctggcgcggcggcgcagcctgcgcatgccggcgctggaggccgtgcggctgctgctg
ggactgggcctgccgctgctgctggcactgcacgtgccggccacgcggctggcgcaggag
gcctggggcgtggacccctcgtatgcgcgcatcgtgcgttcttcctggaatccgtccagc
atggccatccagctgctgctgatgacggctgcctggacccatggctgcatgggcctgcac
atggccctgcgcgcgcgcggctggtggcggcgctggcagccgctgctgctcacggccgcc
gtgctgctgcccgtgctggcggcgctgggcatcgtctccatggcgcgcgagatcgcggcg
gccggcctgccagcgccggccggcccctctcccgaggcatcgcagtggctgcgcgcgctg
acgaccgggctgcgccagggctggctggcctgcctggccgcgctgctggccggcccctgg
ctgtggcggcgcatgcgcctgcgcggcgcccgccaggtgctgctgcactatccgggccgc
accgtgcaggtggcccagggcatgagcgtgctcgaagccagccgcgagcatggcattgcc
catttgtcgctgtgcggcggcagggcgcgctgctccacctgccgggtgcgcgtgtccggc
ccggcggcccacctgcccgcgccggggcgggacgagcgcctcacgctggagcgcgtgggc
gcgccgcaggacgtgcggctggcctgccagctacggcccacgggcgatgtgcaggtggcg
ccgctgttccgctcgccggcagccgcccaggccgggcggggtgacgggcagcgcgaggtc
cgcgaagtgcgcgcggtggccatcctgttcgtggacctgcgccgctggtcgggcctggcc
gagcggcaatggcccgtggacctgtcctgggtgctggaccagtatttcgagcgcgtgggc
caggctgtgcacgacagcggcggcatggccaaccagttcatcggcgacagcgtgatggcc
atcttcgggctggataccgacctggacacggcctgccgccaggccgtgcaggccagcgcc
ctcatcgaccggcgcatgcaggaatggagccacaccttcgaggcgcagttcggccagccg
gtggatttcggcatgggcctgcatgcggggcgcgccgccgtggggcgcgtgggcttcgag
cacaccaccaccttcacggccgtgggcgaggtggtcaacacggccagccgcctgcaggaa
tacaccaagagcgcccaggcgcggctggtgctgtcgctggaggtggcgcgccgcgcgggc
gtggccgatggcctgggcgaagtccggcaggtgcaggtgcgcgggcgctccgagcccttg
ccggccctgcatgtggcgcggcccggcctgcagtggccgtga

DBGET integrated database retrieval system