KEGG   Delftia acidovorans: Daci_5742Help
Entry
Daci_5742         CDS       T00620                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABX38370
UniProt: A9BXU4
Position
6392891..6393919
Genome map
AA seq 342 aa AA seqDB search
MQIQIARRHGDGGNSCRCGFGLRRVAARAIHPWSRCKANSSPTRSYGIAAVTSYSGICFA
CRPIAAAQGNSLRSFDGISAREMWKNDGDEHSPRRDPKMASIIAQPLPFQPSTSLILVAE
DEPEIADILCAYLARSDLRTVHAADGQQALELHHHLKPDLVLLDVQMPRLDGWQVLSEIR
RRGDTPVIMLTALNQDVDKLIGLRIGADDYVGKPFNAAEVVARVQAVLRRCGQGRLRDTK
LLQAGPFRVDLDSREVSVQVQGATHVPELTVTEFNLLASLVRSPRRVFSRAELLLSCLPE
GHTLERTVDSHISKLRKKLEGLGLQGMPDSVRSVGYRLGMDP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccagattgccaggaggcatggggatggaggaaactcctgccggtgcggcttc
ggcctgcggcgtgttgccgccagggccattcatccatggagccgctgcaaagccaacagc
tctcccacccgctcatacggcattgccgctgtgacttcatattcagggatttgtttcgca
tgccggccaattgcggcggcacagggaaacagcttgcgttctttcgatggcatttcggcc
cgggaaatgtggaagaacgatggagatgaacacagcccccgccgcgaccccaaaatggct
tctatcattgcccagcccttgcctttccagccatcgacatcgctcatcctcgtcgccgag
gacgagcccgagatcgcagacatcctgtgcgcctacctggcccgcagcgacctgcgcacc
gtgcatgccgccgatggccagcaggcccttgaactgcaccaccacttgaaacccgatctc
gttcttctcgacgtgcagatgccacgccttgacggctggcaggtgctgtccgaaatccgc
cggcgcggcgacacgcccgtcatcatgctcaccgcactcaaccaggacgtggacaagctc
atcggcctgcgcattggcgcggacgactacgtgggcaagcccttcaacgcggccgaggtc
gtggcgcgcgtgcaggccgtgctgcgccgctgcggccagggccggctccgcgataccaag
ctgctgcaggccggcccctttcgcgtggacctggacagccgcgaggtcagcgtgcaggtg
cagggcgccacgcacgtgcccgaactcaccgtgaccgaattcaacctgctggccagcctg
gtgcgttcgccccggcgcgtgttcagccgcgccgagctgctgctgagttgcctgcccgaa
ggccacacgctggagcgcaccgtggacagccacatcagcaagctgcgcaagaagctcgaa
ggcctgggcctgcagggcatgcccgacagcgtgcgcagcgtgggctaccggctggggatg
gacccatga

DBGET integrated database retrieval system