KEGG   Delftia acidovorans: Daci_5747Help
Entry
Daci_5747         CDS       T00620                                 

Definition
(GenBank) cobalamin biosynthesis protein CobW
  KO
K02234  cobalamin biosynthesis protein CobW
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daci_5747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C DUF2791 Viral_helicase1 AAA_16 NACHT AAA_22 ATPase_2 AAA_33 TrwB_AAD_bind TsaE NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABX38375
UniProt: A9BXU9
Position
complement(6400687..6401736)
Genome map
AA seq 349 aa AA seqDB search
MQTAKIPATIVTGFLGSGKTTLLRHILDNADGRRIAVIVNEFGELGIDGEILKGCGIGCD
DEGNEREGALYELANGCMCCTVQEEFFPVMRALAERRDQIDAVIIETSGLALPKPLVQAF
QWPEIANVFTVDAVVTVVDTPAAASGQFAANPQAVDELRRADPNLDHESPLHELFEDQLG
AADLVVLNKTDLADAEALARVTALVREELPPEVKIVQSSQGRLPLDVVLGLAKAAETTID
QRVSHHDHDEDHDHDDFDSYVIDLPAVDRDRLLAALETLVEQHSILRVKGFADIPGKPMR
WLLQGVGRRFDHHFDRAWREGEQRGTRLVFIGQDLDEAALRKGLENVAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgccaagattcccgccaccatcgtcaccggcttcctgggcagcggcaagacc
acgctgctgcgccacatcctggacaacgccgatggccggcgcatcgcggtcatcgtcaac
gagttcggcgagctgggcatcgacggcgagatcctcaagggctgcggcatcggctgcgac
gacgagggcaacgagcgcgaaggcgcgctgtacgagctggccaacggctgcatgtgctgc
acggtgcaggaagagttcttccccgtgatgcgcgcgctggccgagcgccgcgaccagatc
gacgccgtgatcatcgagacctcgggcctggccctgcccaagcccctggtccaggccttc
cagtggcccgagatcgccaacgtgttcaccgtggacgcggtggtcaccgtggtggacacg
ccagcggccgccagcggccagttcgccgccaatccccaggccgtggacgagctgcgccgc
gccgaccccaacctggaccacgaatcgccgctgcacgaactcttcgaggaccagctgggc
gcggccgacctggtggtgctcaacaagaccgacctggccgatgccgaggccctggcgcgc
gtgaccgccctggtgcgcgaggagctgccgcccgaggtcaagatcgtgcaatcgtcccag
ggccgcctgccgctggacgtggtgctgggcctggccaaggcggccgagaccaccatcgac
cagcgcgtgagccaccatgaccacgacgaggaccatgaccacgacgacttcgactcctac
gtgatcgacctgcccgccgtggaccgcgaccgcctgctggccgcgctggagacgctggtg
gagcagcacagcatcctgcgtgtcaagggctttgccgacatcccgggcaagcccatgcgc
tggctgctgcagggcgtgggccgccgcttcgaccaccatttcgaccgcgcctggcgcgag
ggcgagcagcgcggtacgcgcctggtgttcatcgggcaagaccttgacgaagcagcgctg
cgcaagggcctggagaatgtggccgcctga

DBGET integrated database retrieval system