KEGG   Delftia acidovorans: Daci_5750Help
Entry
Daci_5750         CDS       T00620                                 

Definition
(GenBank) transport system permease protein
  KO
K02015  iron complex transport system permease protein
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
Module
dac_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_5750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5750
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Daci_5750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: ABX38378
UniProt: A9BXV2
Position
complement(6403555..6404577)
Genome map
AA seq 340 aa AA seqDB search
MNSLSHPPAWRPWAGAVLLLLASLLIAACAGHQWASPADLLAALGGEDSLRSRLLLQWRV
PRVLAAALVGALLGLSGAIFQGVFRNPLAEPYLLGASGGAALGATVALLVPMHLLFGLPQ
AWTLPVLAFAGAWGSTVLVLAVSRVAGATDAAGMLLAGVALAAVLGALRSFLMLALSDET
VSLQVVLSWVLGGIQTPSWSGLGLLAGASLACLAGAMALARGLDLLGLGADAAQGFGLDV
ARFTPLAVLAGSLVVAVAVAYGGLVAFVGLAAPHIARWMAGPLHRAALPASALTGAIIVT
LADAIARSVLPPAEIPLGLVTAVAGGPFFIVLLARRLRSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaattccctttcacatccacctgcgtggcgcccctgggccggtgcggtcctgctgctg
ctggccagcttgctgattgccgcctgcgctggccaccagtgggccagcccggccgacctg
ctggccgcgctgggcggcgaagacagcctgcgcagccggctgctgctgcagtggcgcgtg
ccgcgcgtgctggcagccgccctggtgggcgcgctgctgggcctgtcgggagccatcttc
cagggcgtgttccgcaatccgctggccgagccctatctgctgggcgcctcgggcggcgcg
gcgctgggggcgactgtcgccctgctggttcccatgcatctattgttcggcctgccccag
gcatggacgctgcccgtgctggcctttgcgggcgcctggggctcgaccgtgctggtgctg
gccgtctcgcgcgtggccggtgccaccgatgcggccggcatgctgctggccggcgtggcg
ctggcggccgtgctgggcgcgctgcgctcgttcctgatgctggcgctgtccgatgagacg
gtgagcctgcaggtggtgctcagctgggtgctgggcggcatacagacgccgtcctggagc
gggctgggcctgctggccggtgcctccctggcctgcctggccggggccatggcgctggcg
cgcgggctggacctgctgggcctgggtgccgatgcggcccagggcttcggcctggatgtg
gcgcgcttcacgccgctggccgtgctggccggctcgctggtggtggccgtggccgtggcc
tatggcgggctggtggccttcgtgggcctggctgcgccgcacatcgcgcgctggatggcg
ggaccgctgcaccgcgcggccctgccggcgtcggcgctcacgggcgccatcatcgtcacg
ctggccgacgcgattgcgcgcagcgtgctaccgccggccgagatcccgctgggcctggtc
acggccgtggccggcgggcccttcttcatcgtgctgcttgcgcgcaggctgaggtccgca
tga

DBGET integrated database retrieval system