KEGG   Delftia acidovorans: Daci_5752Help
Entry
Daci_5752         CDS       T00620                                 

Definition
(GenBank) TonB-dependent receptor
  KO
K16092  vitamin B12 transporter
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5752
Transporters [BR:dac02000]
 Other Transporters
  Pores ion channels [TC:1]
   Daci_5752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Motif
Other DBs
NCBI-ProteinID: ABX38380
UniProt: A9C0R7
Position
complement(6405526..6407766)
Genome map
AA seq 746 aa AA seqDB search
MRFASSAADSSGLLSVLPLVSSLRPAAAAVLLASCAAAAGAAQEPASGRSADSADDALDA
VFVTATARPEARSRIAGTTQTIDREAIERSSARSVTDLLAENAVGFLSEWTAAQTSMNLR
GASTDGQGRDFRSQVLVLVNGRRAGTANLSKLSPSDVERIEIVRGPSSVIYGSQAMGGVV
NIIMKTGATAPGTRAQVQAGSWDLWRTDAQTAGANDRFDWYFGVSAGGRGDYESGDGGTR
MENTGWKRRGASGALGWQLHELHRVELQLRTDGIYNAGFRGSGANIYSRDNRSNRSLDLT
YEGALPGQRLSWTTHLYSLVDTDEFNWASPVIRSGNSAVPGTARDYNHRQLDATGLRFQP
RLRVSQTNDLLMGFDWERSKLRSDRLRVAMPGGPAGQVAPYDNNQTEQVHALYFEDAQTL
FDDRLTLRAGLRKTWGTTRFDETPNLALAQASTRDYDNHTWSAGATWKATDRLTLRAAAS
TGFRAPTATELASDFTAVGGGRTFGNPNLKPETSRQIEVGAALQQPGWRVDAALFQNTIS
DRIITVSRGATTNTSDYANNAADIVARGLEMQADMDLARALNLTGHQLKAWAGGYYHFSM
RDKGSPASANTDKVQRMYRYEASAGVRYGRGSGRLQGDWSLQLSTLLRGPMWYDTEEALL
IPQGEPSSTFIHRKGAFTIWNLRADYRVSRGVKLFAAVNNLFDLNRHPIFIALDRAPCIA
NPAYQNGGCGTSMAGRELMVGLQAEF
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgcttcttcggccgccgattcctccggccttctctctgttctccctcttgtc
tccagcctgcggcccgcagcggccgccgtcctgctggccagctgcgctgcagcggccggc
gccgcgcaggagccggcttcgggccgctccgcggactccgccgacgatgcgctggatgcc
gtcttcgtgaccgccaccgcgcggcccgaggcgcgcagccgcatcgcgggcaccacgcag
accatcgaccgcgaggccatagagcgctccagcgcgcgctcggtcaccgacctgctggcc
gagaacgccgtgggctttctcagcgaatggacggcggcccagacctcgatgaacctgcgc
ggcgcctccaccgacggccaggggcgtgacttccgcagccaggtgctggtgctggtcaac
ggccggcgcgcgggcacggccaacctgtccaagctcagcccctcggatgtggagcgcatc
gagatcgtgcgcggcccgtcctcggtgatctacggcagccaggccatgggcggggtggtc
aacatcatcatgaagacgggggcgacggcgcccggcacgcgcgcccaggtccaggccggt
tcatgggacctgtggcgcaccgatgcgcagacggccggcgccaatgaccgcttcgactgg
tacttcggcgtgagcgcaggcgggcgcggcgactacgagtcgggcgacggcggcacgcgc
atggagaacacgggctggaagcggcgcggcgccagcggcgccctgggctggcagctgcac
gagctgcaccgcgtggagctgcagctgcgcacggacggcatctacaacgcgggctttcgc
ggatcgggcgccaacatctacagccgagacaaccgcagcaaccgctcgctggacctgacc
tacgagggcgcgctgcccggccagcgcctgagctggacgacccacctctacagcctggtc
gataccgatgagttcaactgggcatcgcccgtgatccgctcgggcaacagcgccgtgccc
ggcacggcgcgcgactacaaccaccgccagctggacgccacgggcctgcgctttcagccg
cgcctgcgtgtcagccagaccaatgacctgctgatgggctttgactgggagcgcagcaag
ctgcgctccgaccgcctgcgcgtggccatgccgggcggcccggcgggccaggtcgcgccc
tacgataacaaccagaccgagcaggtgcacgcgctgtacttcgaggacgcgcagaccctg
ttcgacgaccgcctgaccctgcgtgccggcctgcgcaagacctggggcacgacgcgtttc
gacgagacgcccaacctggccctggcccaggccagcacgcgcgactacgacaaccacacc
tggtcggccggcgccacctggaaggccacggaccggctcacgctgcgcgctgcggcctcc
acggggttccgcgcgcccacggccacggagctggcctcggacttcacggccgtcggcggt
ggccgcaccttcggcaaccccaacctcaagcccgagaccagccgccagatcgaggtcggc
gccgcgctgcagcagcccggctggcgcgtggatgcggccctgttccagaacaccatcagc
gaccgcatcatcaccgtctcgcgcggggcgacgaccaacacctcggactacgccaacaac
gcggccgacatcgtggcgcgcggcctggaaatgcaggccgacatggacctggcgcgggcg
ctgaacctgacgggccaccagctcaaggcctgggctggcggctactaccacttcagcatg
cgggacaagggatcgccagcctcggccaacaccgacaaggtgcagcgcatgtaccgctac
gaggcctcggccggcgtgcgctacgggcgcggcagcgggcgcctgcagggcgactggagc
ctgcagctgtccacgctgctgcgcggtcccatgtggtacgacacggaagaggcgctgctc
atcccgcagggcgagcccagcagcaccttcatccaccgcaagggcgccttcaccatctgg
aacctgcgtgccgactaccgcgtgtcgcgcggcgtcaagctgttcgcagccgtcaacaac
ctgttcgacctgaaccgccatcccatcttcatcgcactggaccgcgcgccctgcatcgcc
aacccggcgtaccagaacggcggctgcggaacgtcgatggcgggccgcgaactcatggtc
ggcctgcaagcagagttttga

DBGET integrated database retrieval system