KEGG   Delftia acidovorans: Daci_5756Help
Entry
Daci_5756         CDS       T00620                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K22589  threo-3-hydroxy-L-aspartate ammonia-lyase [EC:4.3.1.16]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_5756
Enzymes [BR:dac01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.16  threo-3-hydroxy-L-aspartate ammonia-lyase
     Daci_5756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP tify
Motif
Other DBs
NCBI-ProteinID: ABX38384
UniProt: A9C0S1
Position
6410419..6411381
Genome map
AA seq 320 aa AA seqDB search
MTSLPTYDDVAAAAQRIQGHAHRTPVLTSRTLDDALGARVFLKCENLQRMGAFKFRGAFN
ALSRFSPAQRKAGVVAFSSGNHAQAIALAARLLEIPATIVMPHDAPAAKVAATKGYGGQV
VVYDRYTEDREQIGRDLAERHGLTLIPPYDHADVLAGQGTAAKELFEETGPLDALFVPLG
GGGLLSGTALSTRALSPDCALYGVEPEAGNDGQQSLRAGRIVHIETPKTIADGAQTQHLG
GITFPIIQRDVTDILTASDAELVDAMGFLATRMKLVVEPTGCLGLAAARQKSEELRGRRV
GIILSGGNVDMQRFCSLLGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccttcccacctatgacgacgtggccgcagcggcccaacgcatccagggccat
gcccaccgcacgcccgtgctcacctcgcgcacgctggacgatgcgctgggcgcccgcgtc
tttctcaagtgcgagaacctgcagcgcatgggcgccttcaagttccgcggtgctttcaac
gccctgtctcgcttcagcccggcgcagcgcaaggccggcgtggtggcgttttcctcgggc
aaccacgcccaggccatcgccctggcagcccggctgctggagattcccgccaccatcgtc
atgccgcatgacgcgcccgccgccaaggtggcggccaccaagggctatggcggccaggtg
gtggtctatgaccgctataccgaagaccgcgagcagatcggccgcgacctggccgagcgc
cacggcctgaccctgatcccgccctacgaccatgccgacgtgctggccggccagggcacg
gccgccaaggaactgttcgaggaaaccggcccgctggacgccctcttcgtgccgctgggc
ggcggcggcctgctgtcgggcacggccctgtccacgcgcgcgctcagccccgactgcgcg
ctctacggcgtggagcccgaggccggcaacgacggccagcagtcgctgcgcgcgggccgc
atcgtccacatcgaaacgcccaagaccattgccgatggcgcccagacccagcacctgggc
ggcatcaccttccccatcatccagcgcgacgtgactgacatcctcaccgccagcgatgcc
gagctggtcgacgccatgggcttcctggccacgcgcatgaagctcgtggtcgagcccacc
ggctgcctgggccttgccgccgcgcgccagaaaagcgaagagctgcgcggacggcgcgtg
ggcatcatcctcagcggcggcaacgtggacatgcagcgcttttgcagcctgctgggcgcc
tga

DBGET integrated database retrieval system