KEGG   Delftia acidovorans: Daci_5758Help
Entry
Daci_5758         CDS       T00620                                 

Definition
(GenBank) band 7 protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 QSregVF DUF3074
Motif
Other DBs
NCBI-ProteinID: ABX38386
UniProt: A9C0S3
Position
6412236..6413309
Genome map
AA seq 357 aa AA seqDB search
MFGIRFIKSQPTVHLMQFRAGKVVREGAGQSFFYYAPTTTLVAVPVGSQDCHFMLELVTA
DFQSVTVQGQVTYRISTPRQTATLMDFSLARDGQKYLSEDPQRLGDRVTMQAEVIIQQAV
QALELKQALRSSALIARTAQQELAAQPEIEALGLEILGVSVMAVKPTPDIARALEAEARE
SNLKAADDAVYARRMAAVENERAIRQNELDTDVAVEKKKRQIREAQLEAKAAQMRKENEL
RAEQMSADVALETSRRDFVEGQAANSRTLAEAEAYRVGAVMQALEKADPRIVQSLAAVGM
QPGQLIAQAFGGIAEKAERIGQLNVSPELLQSLMGAGAGHAAAVADPEPARSRRERQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcatccgtttcatcaagtcccaacccacggtccacctcatgcagttccgcgcc
ggcaaggtggtacgcgagggtgcgggccagtccttcttctactacgcgcccaccaccacc
ctggtcgcggtgcccgtgggcagccaggactgccacttcatgctggagctggtgacggcc
gacttccagagcgtcaccgtgcagggccaggtcacctaccgcatcagcacaccgcgccag
accgccacgctgatggacttctccctggcgcgcgacggccagaaatacctgtccgaagac
ccgcagcgcctgggcgaccgcgtgaccatgcaggccgaggtcatcatccagcaggccgtg
caggcgctggagctcaagcaggcgctgcgctcctcggcactcattgcgcgcacggcccag
caggagctggccgcccagcccgagatcgaggcgctggggctggagatcctgggcgtctcg
gtcatggccgtcaaacccacgcccgacatcgcccgcgccctcgaggccgaggcgcgcgag
tccaacctcaaggccgcggacgacgccgtctatgcccgccgcatggctgccgtggaaaac
gagcgcgccatccgccagaacgagctcgataccgatgtggccgtggaaaagaaaaagcgc
cagatccgcgaggcccaactggaagccaaggccgcccagatgcgcaaggaaaacgagctg
cgcgccgaacagatgtccgccgacgtggcgctggagaccagccgccgcgacttcgtcgaa
ggccaggccgccaacagccgcaccctggccgaggccgaggcttaccgcgtgggcgccgtc
atgcaggccctggaaaaggccgacccgcgcatcgtgcaatcgctggccgccgtgggcatg
cagccgggccagctcatcgcccaggcctttggcggcattgccgagaaggccgagcgcatc
ggccagctcaacgtctcgcccgagctgctgcagtcgctcatgggcgccggtgcaggccat
gcagctgccgtggccgatcccgaacccgcaaggagccgccgtgaacgccaatga

DBGET integrated database retrieval system