KEGG   Delftia acidovorans: Daci_5759Help
Entry
Daci_5759         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX38387
UniProt: A9C0S4
Position
6413296..6414228
Genome map
AA seq 310 aa AA seqDB search
MNANERKTVLVVRRTRLDELVARYHTLSQARFYIEHLGADFGDYLRESAAYATALQAVVQ
ALEARGRYQIVDRALVPNFVFGADDIVVALGQDGMVANTMKYLDGQPLIGVNPEPARWDG
LLLPFAPADLAALLGDVAANRRPTRAVTLAEARLSDGQVLRAANDLFIGPRSHTSALYDI
ALGDRHESQSSSGLIVATGLGSSAWIKSIVTGSMGIARAVRGASTDFDYQPFAWDAPRLD
FAVREPFPSRSSTAELVYGQVTAGQPLTLRSRMPDHGVIFSDGMEADYLQFTAGMQATIG
LSDRQGCLVV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccaatgaacgcaagaccgtgctggtggtgcggcgcacgcggctcgatgagctg
gtggccaggtaccacacgctgtcccaggcgcgcttctacatcgagcacctgggtgcagac
ttcggcgactacctgcgcgaaagcgccgcctacgccaccgccctgcaggccgtggtgcag
gcgctggaggcgcgcggccgctaccagatcgtggaccgcgccctggtgcccaacttcgtc
ttcggcgccgacgacatcgtcgtggcactgggccaggacggcatggtggccaacaccatg
aaatacctggacggccagccgctcatcggcgtcaaccccgagcccgcgcgctgggacggc
ctgctgctgcccttcgcccccgccgacctggccgccctgctgggcgacgtggccgccaac
cgccgccccacgcgcgccgtcaccctggccgaggcacgcctgagcgacggccaggtgctg
cgcgccgccaacgacctgttcatcggcccgcgcagccacacctcggccctgtacgacatc
gcgctgggtgaccggcacgaatcccagtcgtcctccggcctcatcgtcgccacggggctg
ggctcgtctgcatggatcaagagcatcgtcacgggatcgatgggcattgcccgcgccgtg
cgcggcgcatccaccgacttcgactaccagcccttcgcctgggatgcgccacgcctggac
ttcgccgtgcgcgagccctttcccagccgctcttccacggccgagctggtctacggccag
gtcacggccggccagccgctgaccctgcgctcgcgcatgcccgaccatggcgtcatcttc
tcggacggcatggaagccgactacctgcagttcacggcgggcatgcaggccaccatcggc
ctgtcggaccggcagggctgcctggtggtgtga

DBGET integrated database retrieval system