KEGG   Delftia acidovorans: Daci_5763Help
Entry
Daci_5763         CDS       T00620                                 

Definition
(GenBank) Fimbrial protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial
Motif
Other DBs
NCBI-ProteinID: ABX38391
UniProt: A9C0S8
Position
6417267..6418457
Genome map
AA seq 396 aa AA seqDB search
MLSFPAPHYSLKSSIKLLRDIFENHTSAMDRISIMHFSCIPSFVLRVRRLALIALPFLIA
FSAATMNTNAFAGGVFSPTSSSISLPEEITVPGNYANGSTLWKSTATVFNLKAVLNTAFE
YDVSKAVVFANVQSGTKTPGYNNVYGTNIPGIGIRWWATWRGPSAPNGRTMPITTESENH
SGALGYFWNSSYPQDVWFELVKTGSVSAGTLTGSGMNVEMRFQCPGCIAGNVNLSGRTRV
VVGPSCSVAASTISVPMGAVPILRFTGLQSTSIPQHFDITLECKGGAPESVLRPHITLTD
ANDTSNQSTVLTLSQATSGGKPVATGIGIQILKDGTALGYGPDSNVPGNTNQWSAGTIAQ
GVAQFKIPLTAKYVQTAAAVTTGQANGRATFTLNYQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctttcatttccagcccctcattattcactcaaaagttcaataaaactattgcgtgat
attttcgagaatcatacttcagcaatggaccgaatcagtatcatgcatttctcttgcatc
ccctcatttgtcttgcgagtacgccgccttgcattgatcgcccttccatttctcatcgct
ttttcagcggcaacgatgaacaccaatgcctttgccgggggcgtattctcccccaccagt
tccagcatttcactgcccgaggaaataacagtacccggaaattacgccaacggatcgacg
ctatggaagtctacggcaaccgtatttaatcttaaagcagtgctgaacacggcattcgag
tacgatgtttccaaagccgttgtattcgccaatgttcaatccgggaccaagacgcccgga
tacaataatgtctacggcaccaatattcccggcattggaatccgctggtgggcaacatgg
cgaggccccagcgctcccaatggcagaaccatgcccattaccaccgaatcagaaaatcat
tcgggcgcgctgggctatttctggaatagctcatacccccaggatgtctggttcgagctg
gtgaaaaccggcagcgtttccgctggcaccctaacgggctccgggatgaacgtcgagatg
cgattccagtgccccggctgcatcgcaggaaacgtcaacctgtccggccgcaccagggtg
gtggtcggtccctcctgctcggtggccgcctcgaccatctccgtacccatgggcgctgtg
cccatcctgcgattcacgggcctccaatccacctccatcccccagcacttcgacatcacg
ctggaatgcaagggcggcgcgcccgaaagcgttctgcgtccccacatcacgctcaccgat
gccaacgacaccagcaatcagagcaccgtcctgaccttgagccaggccacgtcaggcggc
aagccggttgccaccggaataggcatacagatactgaaggatggcaccgctctcggctac
ggcccggactccaacgtgcctggcaacaccaaccaatggagtgcgggaaccatcgcccag
ggcgttgcccagttcaagatcccgctgactgccaaatacgtgcagaccgctgcggcagtc
acgacggggcaggccaatggcagggccaccttcacgctgaactaccagtga

DBGET integrated database retrieval system