KEGG   Delftia acidovorans: Daci_5766Help
Entry
Daci_5766         CDS       T00620                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
dac  Delftia acidovorans
Module
dac_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5766
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Daci_5766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ABX38394
UniProt: A9C0T1
Position
6420061..6420987
Genome map
AA seq 308 aa AA seqDB search
MDSRMPRLLSPLAAALALLLGAGAAHADATLDKIKQRGKLSVGIDGASPPFGVLDPATGK
TGGYQTELAADIARRLGVPLETVPVTASTRVQFLQSGKVDLLIANIQWTQERSEILSFAP
TPYDLIGGGALVAKASGIKRWEDLRGKVACVSQGSNFAKPLAESYGAVVKGLRGIPESLL
ALKGGTCAASVHIQPALYEKLTGPNAAEWKDFELGTQDQLIPSPTVVWTRRGETDTQAFV
DKAIQDWHRTGFLLKVARASGVPDTWIAERHEHALKGLFDRAPYDFAVYAAAQADAQATK
AAAKGAKP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggattcacgcatgccccgccttctttccccccttgccgccgccctggccctgctgctg
ggcgccggtgccgcccacgccgatgccacgctggacaagatcaagcaacgcggcaagctg
tccgtgggcatcgacggcgccagcccgccgttcggcgtgctggaccccgccaccggcaag
accggcggctaccagaccgagctggccgccgacatcgcgcgccgcctgggcgtgccgctg
gagacggttcccgtgaccgcctccacgcgcgtgcagttcctgcaaagcggcaaggtggac
ctgttgatcgccaacatccagtggacgcaggagcgcagcgagatcctctcgttcgcgccc
acgccctacgacctgatcggcggcggcgccctggtggccaaggccagcggcatcaagcgc
tgggaagacctgcgcggcaaggtggcctgcgtgtcgcagggcagcaacttcgccaagccc
ctggccgagagctatggcgccgtggtcaagggcctgcgcggcattcccgagtcgctgctg
gcgctcaagggcggcacctgcgcggcttcggtccatatccagcccgccctttatgaaaag
ctcaccggcccgaatgcagccgagtggaaggacttcgagctgggcacgcaggaccagttg
attccctcgcccaccgtggtgtggacgcgccgcggcgagaccgacacccaggccttcgtg
gacaaggccatccaggactggcaccgcacgggctttctgctcaaggtggcccgcgccagc
ggcgtgcccgacacctggatcgccgagcgccacgaacacgcgctgaagggcctgttcgac
cgcgcgccctacgacttcgcggtgtatgcggcagcacaggccgatgcgcaggcaaccaag
gccgccgccaagggagccaagccatga

DBGET integrated database retrieval system