KEGG   Delftia acidovorans: Daci_5775Help
Entry
Daci_5775         CDS       T00620                                 

Definition
(GenBank) Rhodanese domain protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABX38403
UniProt: A9C0U0
Position
complement(6429910..6432234)
Genome map
AA seq 774 aa AA seqDB search
MRAQCPKLISISAMRRWRRGGRGLTSCPPANVLPGTPMTQTHLSIDFSGSDVASRRAAAI
TGFIATARRLLPDPERATPEQLQAVARELEALGLQRELFPHAHFPVSASNPAQVYRLSED
LGGRYALYLSTGLPGKSQPPHDHTTWAIIAGVEGVERNVFFTRGKTDDPLRDTLAVGRSV
DVGSGTSVVLTPTDVHTIELIGEEPGLHLHFYGRGLERMPERVVFESLEGGTFRTFGPPK
SIRHALVTPAALRQALADGEEIAVLDVREAGVFAHRHILFAAPAPAWRLEQLIDRLVPRR
GTRIVLVDGDGTLAHEAAAKLVRLGWPNVSVLEGGTEGWAAEGLEIFSGTNVPSKAFGEV
IEHEKHTPWITSDELGARVQRGDNIVVVDSRTPEEFAAFSLPFALSVPGAELVYRIGEIA
PDPHTLVVVNCAGRTRSIAGAQTLIDAGIPNQVVSLRNGTMDWLLTGRRLAHGRRTPLPE
PGAVALATARERAASVAQRAGVQSIDAAELARFESEATERTLYRFDVRTREEYQAGHLPG
WRWAPGGQLVQATDEYAATRGARIVLADWDGVRALTTGAWLAQLGWEVFTYVPPALATLE
VGAEPVRVLASHAPAPQLSVQQAQELLGEGRAIVFDVDSRPAFEKQHIAGARFAVPDRLP
SFVQALPPAQVVVLTSPDGVLARSVAAELAARTGRDVRSVVGGTSAWAAAGLPLGQGDAD
VLTGDDDQWYSPYAHRDLGLRDAGFRAYLDWELGLVEQLERDGWASGIRLVPAV
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgcagtgcccaaagctcatatccatatctgcaatgcgtcgttggcgccggggc
gggagaggcctaacttcgtgtcctcccgcgaacgtcctcccaggcactcccatgacacag
acccatctctccatcgacttcagcggcagcgacgtggccagccgccgcgcagccgccatc
accggcttcatcgccacggcccggcgcctgctccccgatcccgagcgggccacgcccgag
caactgcaggccgtggcccgcgagctggaggcgctgggcctgcagcgcgaactgttcccg
catgcgcacttccccgtctcggccagcaacccggcccaggtctaccgcctcagcgaagac
ctgggcgggcgctatgcgctgtacctgtccaccggcctgccgggcaagtcccagccgccg
catgaccacaccacctgggccatcatcgcgggcgtcgaaggcgtggagcgcaacgtgttc
ttcacacgcggcaagaccgacgacccgctgcgcgacaccctggcggtggggcgcagcgtc
gatgtgggcagcggaacctcggtagtgctcacgcccaccgacgtgcacaccatcgagctg
atcggcgaggaacccggcctgcacctgcacttctacgggcgcggcctggagcgcatgccc
gagcgcgtggtcttcgagagcctggagggcggcacgttccgcaccttcggcccgcccaag
tcgattcgccatgcgctggtcacgcccgccgcgctgcggcaggccctggccgacggcgag
gaaatcgccgtgctcgacgtgcgcgaggccggtgtcttcgcgcaccgccacatcctgttc
gcggcgccggccccggcctggcggctggagcagctcatcgaccgcctggtgccgcgccgg
ggaacgcgcatcgtgctggtggatggcgacggcacgctggcccatgaagccgccgccaag
ctggtgcgcctgggctggcccaacgtctccgtgctcgaaggcggcaccgaaggctgggcg
gccgaagggctggaaatcttcagcggcaccaacgtgcccagcaaggccttcggcgaagtc
atcgagcatgaaaagcacacgccctggatcacctcggacgaactgggcgcgcgcgtgcag
cgcggcgacaacatcgtcgtcgtcgacagccgcacgcccgaggaattcgcggccttcagc
ctgccctttgccctgagcgtgccgggggccgaactggtctaccgcatcggcgaaatcgcc
ccggacccgcacaccctggtcgtcgtcaactgcgcgggccgcacgcgctccatcgcgggc
gcgcagaccctgatcgacgccggcattcccaaccaggtcgtctcgctgcgcaacggcacc
atggactggctgctcaccggccgcaggctggcccatggccgccgcaccccgctgcccgag
cccggcgccgtcgccctggccacggcacgcgaacgcgcagccagcgtggcacagcgcgcg
ggcgtgcaatccattgatgcggccgaactggcccgcttcgagtccgaagccaccgaacgc
acgctctaccgcttcgacgtgcgcacccgcgaggaataccaggccggccacctgcccggc
tggcgctgggcgccgggcggccaactcgtgcaggccaccgacgaatacgcggccacgcgc
ggcgcacgcatcgtgctggccgactgggacggcgtgcgcgccctcaccaccggcgcctgg
ctggcccagctgggctgggaagtcttcacctacgttccgcccgcgctggccaccctggag
gtcggtgccgaacccgtgcgcgtgctcgcctcccacgcgcctgcgccccagctgtccgtg
cagcaggcgcaggaactgctgggcgaaggccgcgccatcgtcttcgacgtggacagccgg
cccgccttcgagaagcagcacatcgccggtgcgcgctttgccgtgcctgatcgtctgccc
tccttcgtgcaggccctgccgccggcccaggtcgtggtgctgacctcgccggacggcgtg
ctggcgcgcagcgtggcggccgaactggcggcgcgcactgggcgcgatgtgcgttccgtc
gtcggtggcacttctgcctgggctgctgccgggctgccgctggggcagggggatgcggat
gtgctgacgggggatgatgaccagtggtacagcccttatgcgcatcgggatctggggttg
agggatgcggggtttcgggcttatctggattgggagttggggttggttgagcagttggag
cgggatgggtgggcttctgggattcggctggtgcctgctgtttga

DBGET integrated database retrieval system