KEGG   Delftia acidovorans: Daci_5780Help
Entry
Daci_5780         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, HxlR family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR PadR Replic_Relax HTH_34 MarR MarR_2 HTH_20 TrmB HTH_27 HTH_24
Motif
Other DBs
NCBI-ProteinID: ABX38408
UniProt: A9C0U5
Position
6435378..6435905
Genome map
AA seq 175 aa AA seqDB search
MRSKSFEGMACSIATALEAVGDRWAMLVLRDLMLGLSRYDDLRKSTDITNATLTDRLRQL
EQTGLVERRLYQSGPDRYEYLLTPKGRDLSLVIQALAQVGDRWRLQQQAQPPMRFVRAQS
GTPLRLALVEEESGQSVPFSELRVEAGPGADDLTRWRLSKLAAQARTPAAAPGAD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccaagagcttcgagggcatggcctgctcgatcgccaccgcgctggaggccgta
ggcgaccgctgggccatgctggtgctgcgcgacctgatgctgggcctgagccgctatgac
gacctgagaaagtccacggacatcaccaatgccacgctgaccgaccgcctgcgccagctg
gagcagaccggcctggtcgagcgccgcctctaccaaagcggcccggaccgctacgagtac
ctgctcacgcccaagggccgcgacctgtccctggtgatccaggcgctggcccaggtcggc
gaccggtggcgcctgcagcagcaggcccagccgcccatgcgctttgtgcgtgcgcagtca
ggcacgcccctgcggctggcgctggtggaggaggaatcgggccagagcgtgcctttttcc
gagctgcgcgtggaggccggccccggcgcggacgacctgacgcgctggcggctgtccaag
ctggccgcgcaggccaggacgccggcagcggcccccggcgcggattga

DBGET integrated database retrieval system