KEGG   Delftia acidovorans: Daci_5786Help
Entry
Daci_5786         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aim19
Motif
Other DBs
NCBI-ProteinID: ABX38414
UniProt: A9C0V1
Position
6440372..6440611
Genome map
AA seq 79 aa AA seqDB search
MSLLPSSSAPRTPASTPGRTPRRLKPATVARRCVGSLILLAGAVILTGDLVALWRGAGTD
AAPAAAAIAPASGVVPTAR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttctgccttcctcatccgccccccgcacgccggccagcacgccgggccgcacg
ccgcggcgcctgaaacctgccaccgtggcgcgccgctgcgtgggcagcctgattctgctg
gccggcgcggtcatcttgaccggagatctcgtggcgctgtggcgcggcgcaggcactgat
gccgcacccgccgccgcagccattgcgcccgccagcggcgtggtgccaaccgcccgatag

DBGET integrated database retrieval system