KEGG   Delftia acidovorans: Daci_5787Help
Entry
Daci_5787         CDS       T00620                                 

Definition
(GenBank) Mn2+/Fe2+ transporter, NRAMP family
  KO
K03322  manganese transport protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5787
Transporters [BR:dac02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Daci_5787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nramp
Motif
Other DBs
NCBI-ProteinID: ABX38415
UniProt: A9C0V2
Position
6440657..6442027
Genome map
AA seq 456 aa AA seqDB search
MNDTVLAAEQGRFGAIEPDHGHAGTPSLPQVHRSIAVPRGDSRSDNARRVLAFAGPGYMV
AVGYMDPGNWATSIAGGSQFGYSLLAVIFASNLMAMLFQAAAVRLGLASGRDLAQACRAQ
FSPRINLVLWFFCEIAIVACNLAEVLGMAIGLNLLFGLPLVAGVCITVVDVMLILALQSR
GFRCLESVVIALVAVIGLCFAAQLVWLQPPVAAVLRGLLPGMEIVANPQMLYLAVGIVGA
TVMPHNLYLHSSIVQTRRHDTTPQGTRQAIRLATLDSTVALGLALFVNAAILVVAAGAFN
RPGQAPVTELSDAYHLLSPLLGVGIASAVFGVALLASGLSSSVTGTLAGQIVMEGFLQIR
LSPALRALLTRCIAIVPAVVATAWYGSTGASALLVFSQVVLSLQLPFAIVPLLLFTTRRK
TLGELAFGPRMSAVLWGCAALVVSLNLWMLQRLLTA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccgtgcttgcggccgaacagggccgcttcggcgccatcgagccggaccac
ggccacgcgggcacgcccagcctgccgcaggtgcatcgcagcatcgccgtgccgcgcggc
gacagccgctcggacaacgcgcgccgcgtgctggcgtttgccgggcccggctacatggta
gccgtgggctacatggaccctggcaactgggccacctccatcgcgggcggctcgcagttc
ggctactcgctgctggcggtgatctttgcctccaacctgatggccatgctgttccaggcg
gcggccgtgcgcctgggcctggccagcgggcgggacctggcccaggcctgccgcgcgcag
ttttccccgcgcatcaatctggtgctgtggttcttctgcgagatcgccatcgtggcctgc
aatctggccgaggtgctgggcatggccatcggcctgaacctgctgttcggcctgccgctg
gtggccggggtgtgcatcacggtggtggatgtgatgctgatcctggccctgcaaagccgg
ggctttcgctgcctggagtcggtggtgatcgccctggtggccgtgatcggcctgtgcttt
gccgcccagctggtgtggctgcagccgcccgtggcggccgtgctgcgcggcctgctgccg
ggcatggagatcgtggccaatccgcagatgctgtacctggccgtgggcatcgtgggggcc
acggtgatgccgcacaacctgtacctgcattcgtccatcgtgcagacacgccggcatgac
accacgccccagggcacgcgccaggccatccgcctggccacgctggactccacggtggcg
ctggggctggcgctgttcgtgaacgccgccattttggtggtggcggccggtgcgttcaac
cggcccggccaggcgccggtgaccgagctgtcggacgcctaccacctgctgtccccgctg
ctgggcgtgggcatcgccagcgcggtgttcggcgtggcgctgctggcctcggggctgagt
tcttcggtcacgggcacgctggccgggcagatcgtgatggaaggcttcctgcagatccgc
ctgtcgcccgcgctgcgcgccctgctgacgcgctgcatcgccatcgtgcccgccgtggtg
gccaccgcctggtatggcagcaccggcgccagcgccctgctggtgttcagccaggtggtg
ctgagcctgcaattgccgtttgccatcgtgccgctgctgttgttcaccacgcggcgcaag
acgctgggcgagctggcctttggcccaaggatgtcggcggtgctgtggggctgcgcggcc
ctggtggtgtcgctgaacctgtggatgctgcagcggctgctgacggcctga

DBGET integrated database retrieval system