KEGG   Delftia acidovorans: Daci_5788Help
Entry
Daci_5788         CDS       T00620                                 

Definition
(GenBank) Rhodanese domain protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ABX38416
UniProt: A9C0V3
Position
6442177..6442656
Genome map
AA seq 159 aa AA seqDB search
MTALTLETALPQALEEAQEHARAQGLGHAGGVRPPVAWALVQAGQAVLVDVRTAEERKFV
GQVPGTLHVPWATGTALTRNPRFARELEARLAPHGGKEAVALLLCRSGKRSVLAAQAAAQ
AGFAHVFNVLEGFEGEIDARQQRGKNDGWRFHGLPWIQD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagccctcactttggaaaccgccttgccccaggctctggaagaggcgcaggaacac
gcccgcgcacaggggctgggccacgcaggcggcgtgcgcccgcccgtggcctgggcgctg
gtgcaggccggccaggccgtgctggtcgatgtgcgcacggccgaggaacgcaagttcgtc
ggccaggtgcccggcaccctgcacgtgccctgggccacgggcacggcgctgacgcgcaac
ccgcgctttgcccgcgagctggaagcgcgcctggccccgcacggcggcaaggaggccgtg
gccctgctgctgtgccgcagcggcaagcgctcggtgctggcggcccaggcggccgcccag
gccgggttcgcccatgtgttcaacgtgctcgaaggcttcgagggcgagatcgacgcgcgg
cagcagcgcggcaaaaacgacggctggcgcttccacggcctgccctggattcaagactga

DBGET integrated database retrieval system