KEGG   Delftia acidovorans: Daci_5789Help
Entry
Daci_5789         CDS       T00620                                 

Definition
(GenBank) Serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
dac  Delftia acidovorans
Pathway
dac00270  Cysteine and methionine metabolism
dac00920  Sulfur metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01200  Carbon metabolism
dac01230  Biosynthesis of amino acids
Module
dac_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Daci_5789
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Daci_5789
Enzymes [BR:dac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     Daci_5789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep SATase_N Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABX38417
UniProt: A9C0V4
Position
6442669..6443583
Genome map
AA seq 304 aa AA seqDB search
MASFDIAGLTQNLHAARREWREAHGRTQEPGAREFPSRDALSTLIDQLKAALFPMRLGPH
DLRQESEDIFVAHQLDSALHALLGQIRLELRLSAPHTAAGADAMALDIARAFAESLPQIR
RLLDSDVLAAFHGDPAARSVDEVLLCYPGVLAMIHHRLAHQLYLLEQPLLARIVAELSHA
QTGIDIHPGAKIGRGFFMDHGTGVVIGETAVIGERVRLYQAVTLGAKRFPTDEHGHLRKG
LARHPVVEDDVVIYAGATILGRVTLGRGAVIGGNVWVTEDVPPGAHVTQAHAREHAQQPR
EVAL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccagtttcgacattgccggactcacccagaacctgcatgcggcgcgccgcgaatgg
cgcgaggcgcacggccgcacccaggagcccggggcgcgcgagtttccctcgcgcgacgcg
ctttccaccctcatcgaccagctcaaggcagccctgtttcccatgcgcctgggcccgcac
gacctgcgccaggaaagcgaggacatcttcgtggcccaccagctggactcggccctgcat
gcgctgctgggccagatacggctggagctgcggctgtccgcgccccacacggcagcgggc
gccgacgccatggcgctggacatcgcacgcgcctttgccgagtccctgccccagatccgc
cgcctgctagacagcgatgtgctggccgccttccacggcgatcccgccgcgcgcagcgtg
gacgaggtgctgctgtgctatccgggcgtgctggccatgatccaccaccgcctggcccac
cagctgtacctgctggagcagccgctgctggcgcgcatcgtggccgagctgtcgcatgcg
cagacgggcatcgacatccacccgggcgcgaagatcgggcggggctttttcatggaccac
ggcacgggcgtggtgatcggcgagaccgcggtgatcggcgagcgcgtgcggctgtaccag
gccgtcaccctgggcgccaagcgctttcccaccgatgagcacggccacctgcgcaagggc
ctggcgcgccatccggtggtggaggacgacgtggtcatctacgcgggcgccaccatcctg
ggccgcgtcacgctggggcgcggcgccgtcatcggcggcaatgtctgggtgaccgaggac
gtgccgcccggcgcccacgtcacccaggcccatgcgcgcgagcacgcgcagcagccccgg
gaggtggccctatga

DBGET integrated database retrieval system