KEGG   Delftia acidovorans: Daci_5792Help
Entry
Daci_5792         CDS       T00620                                 

Definition
(GenBank) cysteine desulfurase, SufS subfamily
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
dac  Delftia acidovorans
Pathway
dac00450  Selenocompound metabolism
dac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Daci_5792
Enzymes [BR:dac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Daci_5792
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     Daci_5792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP SelA
Motif
Other DBs
NCBI-ProteinID: ABX38420
UniProt: A9C0V7
Position
6444881..6446806
Genome map
AA seq 641 aa AA seqDB search
MTVSAITSVAPQAPFDPEALARMANALFSAAPGSAPALPGLPGLPGLPGLPAGVQAPVNV
APPGSPLASPAGLGPGVPGTPIPQGLAPGSNLLPASPAPLASLAHRAPALLPHAQAGNGV
PDHVVSALPAYEPRLGSQVLGVPQRQGDPLDALAALPFTAPAAPATPAASAAPAVPRIGV
PTEGPGIASTVPSAEPRFYFVDPVVLPAGYTTPAHPLQRQQASHGARHGTAGVQAPFDVH
AVRRDFPILSERVNGRPLAWLDNAATTHKPRAVIERIRHFYEHENSNIHRAAHELAARAT
DAYEGARERVRRFINAPDVNEVIFVRGTTEAINLVAKSWGWQHVGEGDEIIVSHLEHHAN
IVPWQQLAAAKGAKIRVIPVDDSGQVLIDEYRRLLNPRTKIVSVTQVSNALGTVVPVRQI
VELAHQAGARALVDGAQSVSHMAVDVQAIGADFFVFSGHKVFGPTGIGVVWGRREVLEDM
PPWQGGGNMIADVTFEKTVYQPLPNTFEAGTGNIADAVGLGAAIDYVQALGMERIARYEH
DLLQYGTQALAPIPGLRLIGTAADKASVLSFVLKGWTTAEVGEALNAEGIAVRTGHHCAQ
PILRRFGVETTVRPSLAFYNTTEEIDRLAAVVQGLAARRRG
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtgtctgcaatcacctccgtggcgccccaggcgcccttcgaccccgaggcgctg
gcgcgcatggccaacgccctgttctccgccgcaccgggatcggctcctgccctgccgggt
cttccgggtcttccgggtcttcccggcctgcctgctggcgtgcaggcacccgtgaacgtg
gcgcccccgggctcgccgctggccagcccggcaggcctgggccccggcgtgccgggcacg
cccatcccgcagggcctggcgccgggcagcaacctgctgccggcctcgcccgcgccgctg
gcctcgttggcccaccgcgcgcccgcgctgctgccccatgcccaggccggcaacggcgtg
cccgaccatgtcgtgagcgccctgcccgcctacgagccgcgcctgggatcgcaggtgctg
ggcgtgccccagcgccagggcgatccgctggatgcgctggccgcgctcccgttcacggca
cctgctgcacctgcgacacctgctgcatctgcggcacccgccgtgccgcgcatcggcgtt
cccaccgaagggcccggcattgcgtccaccgtgccttcggccgagccgcgcttttacttt
gtcgatcccgtggtgctgcccgccggctacaccacgccggcccatccgctgcagcgccag
caggcttcgcacggggcaaggcatggcacggccggcgtgcaggcgcccttcgacgtgcat
gccgtgcgccgggactttcccatcctgtccgagcgcgtcaacggccgtccgctggcctgg
ctggacaacgcggccaccacgcacaagccgcgcgcggtgatagagcgcatccgccacttc
tacgaacacgagaactccaacatccaccgcgcagcccatgaactggccgcgcgcgccacc
gacgcctacgagggcgcgcgcgagcgcgtgcgccgcttcatcaacgcgcccgacgtgaac
gaggtcatcttcgtgcgcggcaccaccgaggccatcaacctggtggccaagagctggggc
tggcagcatgtgggcgagggcgacgagatcatcgtctcccacctggagcaccacgccaac
atcgtgccctggcagcagctggcggccgccaagggcgcgaagatccgcgtgatcccggtg
gacgactcgggccaggtgctcatcgatgaataccgcaggctgctgaacccgcgcaccaag
atcgtctccgtcacccaggtctccaacgcgctgggcacggtcgtgcccgtgcggcagatc
gtggagctggcccaccaggcgggcgcccgggctctggtcgatggcgcgcagtcggtctcg
cacatggccgtggacgtgcaggccatcggtgcggacttcttcgtgttctcgggccacaag
gtcttcggccccacgggcatcggcgtggtctggggacggcgcgaggtgctggaggacatg
ccgccctggcagggcggcggcaacatgatcgccgacgtgaccttcgagaaaaccgtctac
cagcccctgcccaacaccttcgaggccggcaccggcaacattgccgacgccgtgggcctg
ggcgccgccatcgactacgtgcaggccctgggcatggagcgcatcgcgcgctacgagcac
gatctgctgcagtacggcacgcaggcgctggcgcccatccccggcctgcgcctgatcggc
acggcggccgacaaggccagcgtgctgtccttcgtgctcaagggctggaccacggccgag
gtgggcgaggcgctcaacgccgaaggcatcgccgtgcgcaccggccaccactgcgcccag
cccatcctcaggcgcttcggcgtggagaccacggtgcggccctcgctggccttctacaac
accaccgaggaaatcgaccggctggcggccgtggtgcaggggctggcggcgcgcaggcgg
ggttga

DBGET integrated database retrieval system