KEGG   Delftia acidovorans: Daci_5797Help
Entry
Daci_5797         CDS       T00620                                 

Definition
(GenBank) Dimethylmenaquinone methyltransferase
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: ABX38425
UniProt: A9C0W2
Position
complement(6451314..6451991)
Genome map
AA seq 225 aa AA seqDB search
MSKIPGFHIHARPEAALGDALLQRYRGFPVANVSDAMSRTTGTSALRPFHRRQGPLVGRA
LTVRTRPGDNLMVHQAIDICGPGDVIVVDAGGAGPNAIIGEIMLALMMARGAAGIVIDGL
IRDSDTIGQHGLPVYARGVSHRGPYKDGPGELHVPVSIDGMVVRPGDLVLGDGDGLLAVP
AAEAAAIADRVEAIQRDEADVLAAIAAGRADRSWVARTLAAKGVL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagattcccggattccatatccacgcccggcccgaggccgcccttggcgatgcg
ctgctgcagcgctatcgcggctttccggtcgccaatgtcagcgacgccatgagccgcacc
acgggcacctcggcgctgcggcccttccatcgccgccaggggccgctggtgggccgtgcg
ctgaccgtgcgcacgcgccccggcgacaacctgatggtgcaccaggccatcgacatctgc
ggccccggcgacgtgatcgtggtggacgcgggcggcgccgggcccaacgccatcattggc
gagatcatgctggcgctgatgatggcgcgcggcgcggccggcatcgtcattgacgggctg
atccgcgacagcgacaccatcggccagcacggcctgcccgtgtatgcgcgcggcgtctcg
caccgtggcccctacaaggacggccccggcgagctgcatgtgcccgtcagcatcgacggc
atggtcgtccgcccgggtgacctggtgctgggcgatggcgacggcctgctggccgtgccc
gccgccgaggccgccgccattgccgaccgcgtggaggccatacagcgcgatgaggccgac
gtgctcgccgccattgccgcaggccgcgccgaccgctcctgggtggcgcgcacgctggcc
gccaagggggtgctgtga

DBGET integrated database retrieval system