KEGG   Delftia acidovorans: Daci_5801Help
Entry
Daci_5801         CDS       T00620                                 

Definition
(GenBank) Tail Collar domain protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collar
Motif
Other DBs
NCBI-ProteinID: ABX38429
UniProt: A9C0W6
Position
6455433..6455954
Genome map
AA seq 173 aa AA seqDB search
MSEAYIGEIRLFAGNYAPQNWALCDGRLIAISENDALFALLGTTYGGDGVTNFALPNLQG
RLPIGQGQLPGGSNRVLGQHMGAEDVTLSISQLPGHTHQFSVAGAASTSKPQQQVPAAVT
GFNLYAPSPATTAATLGPSSMQIVGGGQPHNNVMPSLVLSYIICLFGIFPSFA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcatatattggagaaatccgtctttttgcgggcaactatgccccccagaac
tgggcattgtgcgacggcaggctgattgccatcagcgagaacgacgcactcttcgcgctg
ctgggtaccacctatggcggcgacggcgtcaccaacttcgcactgcccaacctgcagggc
cgacttcctattggccaaggccagttgccgggcgggagcaaccgcgttctgggccagcac
atgggtgcggaagacgtaacgctgagcatcagccagttgcccgggcacacccaccagttc
tcggtggctggcgccgccagcaccagcaagccacaacagcaggtaccggcagccgtcacg
gggttcaacctctacgccccctcacccgccacgactgccgccaccctgggacccagctcg
atgcagatcgtcggcggcgggcagccgcacaacaacgtcatgcccagcctggtgctgagc
tacatcatctgcctcttcggcatcttccccagcttcgcatag

DBGET integrated database retrieval system