KEGG   Delftia acidovorans: Daci_5806Help
Entry
Daci_5806         CDS       T00620                                 

Definition
(GenBank) Endoribonuclease L-PSP
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjgF_endoribonc Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: ABX38434
UniProt: A9C0X1
Position
complement(6461677..6462147)
Genome map
AA seq 156 aa AA seqDB search
MTADERFAQAALELGHRFDGEIKIGGNYSPVVRDGQQLFVSGQIPRVGDEVLYVGTVGAG
IDLASARTAAAICAMRALAFVQRAAGSLDAVRAVARITVYVRSAPDFTQQSEVADGASDL
IARVLGPVGAHTRTSVGVLQLPKGAAVELDLIARVD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagatgaacgcttcgcccaggccgccctcgagctcggccaccgcttcgatggc
gagatcaaaataggcggcaactacagccccgtcgtgcgcgacggccagcagctgttcgtc
agcgggcagattccccgcgtgggcgatgaagtgctctacgtggggacggtcggcgccggg
atcgacctggcatcggccagaacggccgccgccatctgcgccatgcgcgccctggccttc
gtgcagcgcgcagccggctcgctcgatgccgtgcgcgccgttgcacgcatcaccgtctat
gtgcgctcggcgcccgatttcacccagcaaagcgaggtggccgatggcgcctccgacctc
atcgcccgggtgctgggccccgtgggtgcccacacgcgcacttcggtgggcgtgctgcag
ctgcccaagggcgctgccgtggagctggacctgatcgcccgcgtggactga

DBGET integrated database retrieval system