KEGG   Delftia acidovorans: Daci_5808Help
Entry
Daci_5808         CDS       T00620                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
dac  Delftia acidovorans
Module
dac_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5808
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Daci_5808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_6 ABC2_membrane ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ABX38436
UniProt: A9C0X3
Position
complement(6463159..6464028)
Genome map
AA seq 289 aa AA seqDB search
MGPHQRLHRMHRLQHLLRPYKAAFASRFLLMLQYRTAAYAGFATQCWWGAIKTMVLAAFY
GSASASAGAPISLEHAITYTWLAQGLFALLPWSGDPDVALAVRTGAVAYDRLRPVDAYAL
WFVRSAGWIAARVLPRVALMVAFAGLALPLMGLGAWGWQPPAGWAAGLGFAASMLLALLL
STALVMLLNVAAAAALNEKGINTLAAPVVIVLSGNLLPLALMPDAWQAALLLQPLAGVMD
IPARIYFGQMAGAQMLACLALQALWIAVIVALGRVAMARTMRGLEVQGG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgcaccagcgcctgcaccgcatgcaccgcctgcaacacctgctgcgcccctac
aaggccgccttcgcctcgcgctttctgctgatgctgcagtaccgcacggccgcctacgcg
ggctttgccacgcagtgctggtggggcgccatcaagaccatggtgctggcggcgttctac
ggcagcgcctcggcatcggccggcgcgcccatctcgctggagcacgccatcacctacacc
tggctggcccagggcctgttcgcgctgctgccctggagcggcgaccccgacgtggccctg
gccgtgcgcacgggtgccgttgcctatgaccggctgcggcccgtggatgcctatgcgctg
tggttcgtgcgctcggctggctggatcgccgcgcgcgtgctgccgcgcgtggcgctgatg
gtggcgtttgcagggctggccctgccgctgatggggctgggcgcctggggctggcagccg
ccggccggctgggccgcaggcctgggctttgccgcctccatgctgctggcgctgctgctg
tccacggcactggtcatgctgctgaacgttgccgctgccgccgcgctcaatgaaaaaggc
atcaacacgctggccgcgcccgtggtcatcgtgctgtcgggcaacctgctgccgctggcg
ctgatgcccgacgcctggcaggccgctctgctgctgcagccgctggccggtgtgatggac
attcctgcgcgcatctatttcggccagatggccggtgcgcagatgctggcctgcctggcg
ctgcaagccttgtggattgccgtgatcgtggccctgggccgcgtggccatggcgcgcacc
atgcgcggcctcgaagtgcagggcgggtga

DBGET integrated database retrieval system