KEGG   Delftia acidovorans: Daci_5810Help
Entry
Daci_5810         CDS       T00620                                 

Definition
(GenBank) potassium efflux system protein
  KO
K11747  glutathione-regulated potassium-efflux system protein KefB
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5810
Transporters [BR:dac02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Daci_5810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N NAD_binding_7 AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABX38438
UniProt: A9C0X5
Position
6465008..6466840
Genome map
AA seq 610 aa AA seqDB search
MEIRLAARTLTQRKHNMAAEGNASQLVGIVTLLGAAVVAVPLFKRLGLGAVLGYLAAGLA
IGPYGLGLVTDAQTILHVAELGVVMFLFVIGLEMKPSHLWDLRGQIFGLGSLQVVVCALL
LTGVGMAFGFPWQVAFVSGAGFVLTSTAIVMQVLAERGDILAPRGQRIVSILLFEDLLIV
PLLAVVAFLAPADAAPVATSPLWQRAGVALLSLGALVGAGLWLLNPLFRILAKAKAREVM
TAAALLVVLGAALLMEMGGLSMAMGAFVAGVLLSESSFRHQLEADVEPFRGLLLGLFFLG
VGMALNLEVVALNWRIVGLGVVALMLGKALCIYAVARVARSSHADALDRAILMAQGGEFA
FVLFAEALKLGVLDPEVHANMTAIVVLSMAITPLVVVLHKRLAGAEAVSLDGVEAPQDLR
GNVLVIGFGRVGQIASQGPLARGAKLSIIDNDPDVIRNAEPYGFKVYFGDGARADILHAA
GASHASAILVCVDSKAAATRIVENVRHECPHARLIVRAYDREHALELIQKDADHVVRESF
ESALLMGHHAVLALGATEDEAQTLEAEVRGRDTERFALETAGGNFAGRALLLGNIERIDP
PRHDKPTARD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccgccttgccgcacgcacgctcacacaaaggaaacacaacatggcagctgaa
ggcaatgcaagccagctcgtaggaatcgtcacgctgctgggggccgccgtggtggccgtg
ccgctgttcaagcggctgggcctgggcgccgtgctcggctacctggccgccggcctggcc
atcggcccctatgggttgggcctggtgacggacgcgcagaccatcctgcacgtggccgag
ctgggcgtggtgatgttcctcttcgtcatcgggctggagatgaagccttcgcacctgtgg
gacctgcgcggccagatcttcgggctgggcagcctgcaggtggtggtgtgcgcactgctg
ctcacgggcgtgggcatggccttcggctttccgtggcaggtggccttcgtcagcggcgcg
ggcttcgtgctgacctccacggccatcgtcatgcaggtgctggccgagcgtggcgacatc
ctggcaccgcgcggccagcgcatcgtctccatcctgctgttcgaggacctgctcatcgtg
ccgctgctggccgtggtggcctttctggcgcctgccgatgcggctcccgtggccacctcg
cccctgtggcaacgcgcgggcgtggccctgctgtcgctgggcgcgctggtgggcgcgggc
ctgtggctgctgaacccgctgttccgcatcctggccaaggccaaggcgcgcgaggtgatg
acggccgccgcgctgctggtggtgctgggcgccgccctgctgatggagatgggcggcctg
tccatggccatgggcgccttcgtggcgggcgtgctgctgtccgaatcctcgttccgccac
cagctggaggccgatgtggagcccttccgcggcctgctgctgggcctgttcttcctgggc
gtgggcatggcgctgaacctggaggtggtggcgctgaactggcgcatcgtgggcctgggc
gtggtcgctctgatgctgggcaaggcgctgtgcatctacgccgtggcccgcgtggcacgc
agcagccatgccgatgcgctggaccgcgccatcctcatggcccagggcggggagttcgcc
ttcgtgctgtttgccgaggcgctcaagctcggcgtgctcgaccccgaggtgcatgccaac
atgacggccatcgtcgtgctgtccatggccatcacgccgctggtggtggtgctgcacaag
cgcctggcaggcgccgaggccgtgtcgctggacggcgtggaggcgccgcaggacctgcgc
ggcaacgtgctggtcatcggcttcggccgcgtgggccagatcgccagccaagggccgctg
gcccgtggcgccaagctgtccatcatcgacaacgaccccgacgtgatccgcaacgccgag
ccctacggcttcaaggtctacttcggcgacggcgcgcgcgccgacatcctgcatgcggcc
ggcgccagccatgccagcgccatcctggtctgcgtggacagcaaggccgccgccacgcgc
atcgtggagaacgtgcgccacgaatgcccgcacgcccgcctcatcgtgcgcgcctatgac
cgcgagcacgcgctggagctcatccagaaggacgccgaccatgtcgtgcgcgaaagcttc
gagtccgccctgctcatgggccaccatgccgtgctggccctgggcgccaccgaggacgag
gcccagacgctggaagccgaagtgcgcggccgcgacaccgagcgctttgcgctggagacc
gccggcggcaactttgcggggcgcgcactgctgctgggaaatatcgagcgcatcgatccg
ccccggcacgacaagcccaccgccagggactga

DBGET integrated database retrieval system