KEGG   Delftia acidovorans: Daci_5812Help
Entry
Daci_5812         CDS       T00620                                 

Definition
(GenBank) TonB family protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C TonB_2 Cytidylate_kin2
Motif
Other DBs
NCBI-ProteinID: ABX38440
UniProt: A9C0X7
Position
complement(6467321..6467674)
Genome map
AA seq 117 aa AA seqDB search
MPRMRCAILALTLGLLAGGPAAAGVVQPVPDRQASENKMPAYPKEARRLEQEGKVVLRVL
VGASGKALAVDVADSSGYPLLDQEALDAVRTWRFVPGTRDGVPDSMWTRVPVTFLLK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcatgcgctgcgccatccttgcattgaccctgggcctgctggccggcggcccg
gctgcggcaggcgtggtgcagcctgtgcccgacaggcaggccagcgagaacaagatgccg
gcctatcccaaggaagccaggcggctggagcaggaaggcaaggtggtgctgcgggttctg
gtgggcgccagcggaaaggcactggccgtggatgtggcagacagcagcggctatcctctg
ctcgaccaggaggcgctggacgccgtgcggacgtggcgctttgtccccggcacgcgcgac
ggcgtgccggacagcatgtggacgcgcgtgcccgtcaccttcctgctgaaatag

DBGET integrated database retrieval system