KEGG   Delftia acidovorans: Daci_5814Help
Entry
Daci_5814         CDS       T00620                                 

Definition
(GenBank) VRR-NUC domain protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VRR_NUC FANC_SAP TPR_7 TPR_2 TPR_6 TPR_1
Motif
Other DBs
NCBI-ProteinID: ABX38442
UniProt: A9C0X9
Position
complement(6470112..6471788)
Genome map
AA seq 558 aa AA seqDB search
MLPPHRFYYLHNFQRALDWIGQRYGDLLDAPEQAFLTRFTQLPQPSQALMVRLLMRRGPW
FRAGKLVYEEIPAIADAAAPLLELGWLDAGHPMALEELFALHTKPELLQLFAGAPVHSGL
RKAELLQALQPLHEAPRPYAQWQPQGVAAGESAWRVMVGALCERFRLMFFGNLYQDWSEF
VLADLGVFRYEAVAFDAASRAFQSRADVDGYLALQACRAALDEGVEIDALLQQVAGCASG
NAWLEQRRAKVLLRIGQACERMQDWERAEQAYAQSRYPGARHRRMRVYERMERFADAMAL
AQAAQAQPESDEELQRVARMLPRLRRSLGQGARGRAAALAPVVAQMRMDVELELPARPAS
VEYVLRDHWHSDSAPVFYVENALINSLFGLLCWPAIFAPLPGAFFHPFQSGPADLSAPDF
VQRRAALFEECLAHLDDGSWREVIVQRHADKQGLQSPFVFWGTLSAPLLALALDCIPAAH
LKLFFARLLRDVQANRTGFPDLVRFWPAERRYELVEAKAPGDKLQDNQIRWLQYCAEHGI
PVRVCHVQWRGQPLGEAA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgctccctccccaccgcttctactacctgcacaacttccagcgcgcgctggactggatt
ggccagcgttacggcgatctgctggacgcgcccgagcaggcattcctcacccgtttcacg
cagctgccccagccctcgcaggcgctgatggtgcgtttgctgatgcggcgcgggccgtgg
tttcgggccggcaagctggtgtacgaagagattcccgccattgccgacgcggccgcgccc
ctgctggagctgggctggctggatgcgggccaccccatggcgctggaggagctgtttgcg
ctgcacaccaagcccgagctgctgcagctgttcgcaggcgcacccgttcactcaggcctg
cgcaaggccgagcttttgcaggccctgcagcccctgcatgaggcgcccaggccctatgcg
cagtggcagccccagggtgtcgcagccggcgaatccgcctggcgtgtgatggtgggcgcg
ctgtgcgagcgctttcggctgatgttcttcggcaacctctaccaggactggtcggaattc
gtgctggccgacctgggcgtgttccgctacgaggccgtggccttcgatgcggcgtcgcgg
gccttccagtcgcgtgccgatgtcgatggctacctggccctgcaggcctgccgcgcggcg
ctggatgagggcgtggagatcgatgcgctgctgcagcaggtggccggatgcgccagcggc
aatgcctggctggagcagcgccgcgccaaggtgctgctgcgcataggccaggcctgcgag
cgcatgcaggactgggagcgtgccgagcaggcttatgcgcaaagccgctaccccggcgcc
cgccaccggcgcatgcgcgtgtacgagcgcatggagcgctttgccgatgccatggcgctg
gcccaggccgcccaggcccagcccgagagcgacgaggagctgcagcgcgtggcgcgcatg
ctgccgcgcctgcgccgcagcctggggcagggcgcgcgcgggcgtgcggcggcgctggcg
cccgtggtggcgcagatgcgcatggacgtggagctggagctgccggcgcggcccgcatcg
gtcgagtacgtgctgcgcgaccactggcacagcgactccgcgccggtgttctacgtggag
aacgcgctcatcaactcgctgttcggtctgctgtgctggccggccatcttcgcgccgctg
ccgggcgccttcttccaccccttccagagcggcccggccgacctgtccgcgcccgacttc
gtgcagcgccgcgcagccttgttcgaggaatgcctggcgcatctggacgatggcagctgg
cgcgaggtcatcgtgcagcgccatgccgacaagcagggcctgcagtcacccttcgtgttc
tggggcacgctgagcgcgccgctgctggcgctggcgctggactgcattccagccgcccac
ctcaagctgttctttgcgcggctgctgcgcgacgtgcaggccaaccgcacgggctttccc
gatctggtgcgtttctggccggccgagcgccgctacgaactggtcgaggccaaggccccc
ggcgacaagctgcaggacaaccagatccgctggctgcagtactgtgccgagcacggcatt
cccgtgcgcgtgtgccatgtgcagtggcgcggccagccgctgggagaggccgcgtga

DBGET integrated database retrieval system