KEGG   Delftia acidovorans: Daci_5815Help
Entry
Daci_5815         CDS       T00620                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Glyco_tran_WecB NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABX38443
UniProt: A9C0Y0
Position
complement(6471898..6472710)
Genome map
AA seq 270 aa AA seqDB search
MDMQQRQLELAGPLPALAPSGRLRGRVCLVVGATSGIGRATALRMAEEGAAAVVVTGRRR
ELGLQLEQEIRQRGADGLFLACDATRQEDMAAVVEQAVERFGRLDAAFNNAGFQERRAVL
AEQDDAVFSQVFDTNVRAVFHAMRHELAAMLAAGGGTIVNNTSVSGIRNPNPGLSLYGAS
KAAALSLTRAAAMEYAPRGIRINAVAPGRVVTDMMLGSGIADMHAVAAGLPLRRMGHPQE
VATAVVWLMSDEAAFVVGHCLATDGGFLAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcagcagcgtcagttggaactggccggtcccctgccagcccttgcaccatcg
gggcggctccgggggcgtgtctgcctggtggtgggcgccaccagcggcataggccgggct
accgccttgcgcatggccgaggagggcgctgccgccgtggtggtcacggggcgccgccgt
gagctgggcctgcagctggagcaggaaatccggcagcggggggcagacggccttttcctg
gcctgcgatgcaacgcggcaggaggacatggcggcggtggtggagcaggccgtggagcgc
ttcgggcggctggacgcggccttcaacaatgcgggcttccaggagcggcgtgccgtgctg
gccgagcaggatgacgcggtcttttcccaggtcttcgatacgaatgtgcgtgcggtcttc
cacgccatgcgccatgaactggcggccatgctggccgcgggcggcggcaccatcgtgaac
aacaccagcgtcagcggcatacgcaatcccaacccgggcctgtcgctgtacggcgcctcc
aaggcggcggccctgtcgctgacccgcgccgccgccatggagtacgcgccgcgcggcatc
cgcatcaatgccgttgcccctggccgcgtggtcacggacatgatgctgggctcaggcatt
gccgacatgcatgccgtggcggcgggcctgccgctgcggcgcatgggccatccgcaggag
gtggccacggccgtcgtctggctgatgtcggacgaggcggcctttgtggtcgggcactgc
ctggcgaccgatggcggcttcctggccggatga

DBGET integrated database retrieval system