KEGG   Delftia acidovorans: Daci_5819Help
Entry
Daci_5819         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC
Motif
Other DBs
NCBI-ProteinID: ABX38447
UniProt: A9C0Y4
Position
complement(6475400..6476389)
Genome map
AA seq 329 aa AA seqDB search
MEIPMTHFQRFLSMAFLALGLVLGLAPLPGHAAEFPEKPVRIVVPFPAGAAADAAMRVVA
RKMSELWRQPVVIDNRPGVHGFQLVSSAPADGYTLLLGAGSGMVTAPLLSSKLSYNPSRD
FVPVGRVLINVPILTTHPSLNVSTVQELVALARKNPGALNYSSSGNGTPGHLSMEMFQAA
TGTRMLQIPYKGGAPAVNELVGGHVQLGINAVPSVVLQIKAGKLTPLAVASATRSRALPQ
VPTMAEAGVKDFEYDIWYALFAPTGTPPAVVAKVNAALVRSLQDREVAKSLEAQGAEPAP
TTPQELARFMQEDTARWAKLVKERNLKLD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggagattcccatgacccacttccaacgcttcctgtccatggctttcctggcactgggc
cttgtgctgggcctggcgcccttgcccggccatgcggccgaattcccggaaaagcccgtg
cgcatcgtcgtgccgttccccgccggtgccgcagccgatgccgccatgcgcgtggtggcc
cgcaagatgtccgagctgtggcgccagcccgtggtcatcgacaaccgccccggcgtgcat
ggcttccagctggtgtcctccgcgccggccgatggctacaccctgctgctgggcgcgggc
tcgggcatggtgacggcgccgctgctgtccagcaagctgtcctacaacccctcgcgcgac
ttcgtgcccgtggggcgggtgctgatcaacgtgcccatcctgaccacgcaccccagcctc
aatgtgagcaccgtgcaggagctggtggcgctggcgcgcaagaaccccggcgcgctgaac
tacagctccagcggcaacggcacgccaggccatctgtccatggaaatgttccaggctgcc
acgggcacgcgcatgctgcagattccctacaagggcggcgcgcccgccgtcaacgaactg
gtgggcggccatgtgcagctgggcatcaatgccgtgcccagcgtggtgctgcagatcaag
gccggcaagctcacgccgctggccgtggccagcgccacgcgctcgcgcgccctgccgcag
gtgcccaccatggccgaggcgggcgtcaaggacttcgaatacgacatctggtatgcgctg
ttcgcgcccaccggcacgccgcctgcggtggtggccaaggtcaatgccgcgctggtgcgc
tcgctgcaggaccgtgaagtggccaagtctctggaggcgcagggcgccgagcccgcgccc
accacgccccaggagctggcgcgcttcatgcaggaagacacggcgcgctgggccaagctg
gtcaaggaacgcaacctcaagctcgactga

DBGET integrated database retrieval system