KEGG   Delftia acidovorans: Daci_5820Help
Entry
Daci_5820         CDS       T00620                                 

Definition
(GenBank) porin Gram-negative type
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 Porin_1
Motif
Other DBs
NCBI-ProteinID: ABX38448
UniProt: A9C0Y5
Position
complement(6476414..6477430)
Genome map
AA seq 338 aa AA seqDB search
MKALPSIAAVCSLSIAALGHPIAHAQDMQVYGQIRLTVNHLKTGNAGSTMEERDNASRLG
FRGKEELGGGLQALFGMEMGLDADTGSLTTPAFRNSYVALRGSLGTVALGRLDSANPTGS
PLYSQVTGITSFAANDAGATAIGTSMLNARNRTSNSLGYQSPSWGGTVFRARYYLRGDAK
APGLEDDARSLDLGLSYAAGPWTAGLGYAKDTRAGGLLANEFDSKWQMGLRYSFGAIEPY
VLLGRDRFNHKPGVSRADVDYWMLGTRLRHGAHAVVLNLMQRDVQTSLTGKRRRQQLAYT
YALSKRTELQAFVDHDGVDSSRPNVAVRAIGAGVRHDF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctgccaagcattgccgccgtctgcagcctgtccatcgctgccctgggccac
ccgattgcgcatgcgcaggacatgcaggtctacggccagatccggctgaccgtgaaccac
ctcaagaccggcaatgccggctccaccatggaagagcgcgacaacgcctcgcgcctgggc
tttcgcggcaaggaggagctgggcggcggcctgcaggcgctgttcggcatggagatgggg
ctggatgcggacacgggctcgctgaccacgccggcctttcgcaacagctacgtggcgctg
cgcggcagcctgggcacggtggccctgggccggctggactcggccaatcccacgggctcg
ccgctgtactcgcaggtcacgggcatcacctcgttcgcggccaatgacgccggggccacg
gccatcggcacctccatgctcaatgcgcgcaaccgcacctccaattcgctgggctaccaa
agcccgtcgtggggcggcacggtgttccgtgcgcgctactacctgcgcggcgatgccaag
gccccagggctggaggacgacgccagatcgctggacctgggcctgagctacgccgcaggc
ccgtggacggccggcctgggctacgccaaggacacgcgcgccgggggcctgctggccaac
gagttcgacagcaaatggcagatgggcctgcgctacagctttggtgccatcgagccctat
gtgctgctgggccgtgaccgcttcaaccacaagcccggcgtctcgcgcgccgacgtggac
tactggatgcttggcacgcggctgcgccatggcgcacacgccgtggtgctcaacctgatg
cagcgcgacgtgcagacctcgctgaccggcaagcgcaggcgccagcagctggcctatacc
tatgcgctgtccaagcgcaccgaactgcaggccttcgtggaccacgacggcgtggactcc
agccgccccaacgtggccgtgcgcgccatcggcgcgggcgtgcgccatgacttctga

DBGET integrated database retrieval system