KEGG   Delftia acidovorans: Daci_5824Help
Entry
Daci_5824         CDS       T00620                                 

Definition
(GenBank) ABC transporter related
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
dac  Delftia acidovorans
Module
dac_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5824
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Daci_5824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase AAA_29 SbcCD_C Rad17
Motif
Other DBs
NCBI-ProteinID: ABX38452
UniProt: A9C0Y9
Position
complement(6480624..6481439)
Genome map
AA seq 271 aa AA seqDB search
MTQTEAFSPDAPAPVLQARGAGFGYAPGKAVFEDISLSIAPREIVCLLGGSGCGKSSLLR
VLGGLESPDGGAWSRGELQFLGQPLTAPHPRAGFVFQQPSLLPWLDARRNVGFGLDFERQ
PKLEAEARSQRVEQALQAVGLGGSGALYPSQLSGGMAQRVALARALAREPQLLLADEPFS
ALDAITRAEMQELMVDVVHRWHTAALLVTHDIDEAILVGDRILLMGGRPGHIVREWRVDI
ARPREDEAAAVTALRLDILSALHGVRHAAQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacggaagctttctcccctgacgctcccgcgcccgtgctgcaggcacgcggc
gcgggctttggctatgcgcccggcaaggccgtgttcgaggacatctccctgagcattgcc
ccgcgcgagatcgtctgcctgctcggcggcagcggctgcggcaagtcctcgctgctgcgc
gtgctcggcggcctggagtcgccggacggcggcgcctggagccggggcgagctccagttc
ctcggccagccgctgaccgcgccgcacccgcgcgcgggcttcgtgttccagcagcccagc
ctgctgccctggctggacgcgcggcgcaacgtgggcttcggcctggacttcgagcgccag
ccgaagctggaggccgaggcccgcagccagcgcgtggagcaggcgctgcaggccgtgggc
ctgggcggcagcggcgcgctctacccctcgcagctgtcgggcggcatggcccagcgcgtg
gccctggcgcgcgccctggcccgcgagccgcagctgctgctggccgacgagccgttctcg
gccctggacgccatcacgcgcgccgagatgcaggagctgatggtggacgtggtccaccgc
tggcacacggccgcgctgctggtcacgcatgacatcgacgaggccatcctcgtgggcgac
cgcatcctgctgatgggcgggcggcccggccacatcgtgcgcgaatggcgcgtggacata
gcgcgcccgcgcgaggacgaggccgccgccgtgaccgcgctgcggctggacatcctctcg
gccctgcacggcgtgcgccatgcggcccaggcctga

DBGET integrated database retrieval system