KEGG   Delftia acidovorans: Daci_5825Help
Entry
Daci_5825         CDS       T00620                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: ABX38453
UniProt: A9C0Z0
Position
complement(6481436..6482533)
Genome map
AA seq 365 aa AA seqDB search
MLADSLRQWLDAHADSLDEGPAHAHEVLPRLAQHGLFGLGVPVAEGGQGGSLGDALEAIA
GVAGHSLTAGFVFWAQRAFVEYLLQSPNAALRQRWLPGLLQGTQAGATGLSNAMKYLGGI
EALQVEATPVGTVGAVGADGLALRGRVPWATNLVPPGRFVVAVAVSRSDGAKPFVAALPG
DAAGLQRSADLDLIALRGSHTAALSIEGLQIGPADVIHADANHFLPRVRPAFMGLQLGLC
IGLARASLAAASARAGAGRDVLGGPLQQQRHALELATATLHAGLSDGRFLDRPQALFRLR
LELNDIVQQSLQLELHASGGRAYHRDQPLGFARRWREAAFIPIVTPSVTQLQGALAGAAL
ATTSS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgattcgctgcggcagtggctggacgcccatgccgactccctggacgaaggc
cccgcgcatgcgcacgaggtgctgccccggctggcgcagcacggcctgttcggcctgggc
gtgcccgtggccgagggcgggcagggcggcagcctgggcgatgcgctggaggccattgcc
ggcgtggccgggcattcgctgacggcgggcttcgtgttctgggcgcagcgcgcctttgtc
gaatacctgctgcagtcgcccaacgcggcgctgcgccagcgctggctgccgggcctgctg
cagggcacgcaggcgggcgccacgggcctgtccaacgccatgaagtacctgggcggcatc
gaagccctgcaggtcgaggccacgcccgtcggcactgtcggcgctgtcggcgccgacggc
cttgcactgcgcgggcgcgtgccctgggccaccaacctggtgccgccgggtcgcttcgtg
gtggccgttgccgtctcgcgcagcgacggtgcaaagcccttcgtggccgcgctgcccggc
gatgcggcgggcctgcagcgcagcgccgacctggacctgatcgcgctgcgcggcagccat
acggcggcgctgtccatcgaggggctgcagatcggcccggccgatgtgatccatgccgac
gccaaccatttcctgccgcgcgtgcggcccgccttcatgggcctgcagctggggctgtgc
atcggcctggcgcgcgcctcgctggcggcggcctcggcccgtgccggcgccgggcgcgat
gtgctgggaggcccgctgcagcagcagcgccacgcgctggaactggccacggccacgctg
catgcgggcctgtccgacgggcgttttcttgaccgacctcaagccctgttccgcctgcgc
ctggaattgaacgacatcgtgcagcagtccctgcagctggagctgcacgccagcggcggg
cgcgcttatcatcgcgaccagccgctgggatttgcgcgccgttggcgcgaggcggccttc
atccccatcgtgacgcccagcgtcacgcagctacagggtgcgctggctggcgcggccctg
gcaaccaccagttcatga

DBGET integrated database retrieval system