KEGG   Delftia acidovorans: Daci_5831Help
Entry
Daci_5831         CDS       T00620                                 

Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
dac  Delftia acidovorans
Pathway
dac00290  Valine, leucine and isoleucine biosynthesis
dac00770  Pantothenate and CoA biosynthesis
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01130  Biosynthesis of antibiotics
dac01210  2-Oxocarboxylic acid metabolism
dac01230  Biosynthesis of amino acids
Module
dac_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
dac_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Daci_5831
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Daci_5831
Enzymes [BR:dac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Daci_5831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ABX38459
UniProt: A9C0Z6
Position
6487788..6489560
Genome map
AA seq 590 aa AA seqDB search
MTDPKTPSPAHDITPADAESGISKGLTNYGDRGFSLFLRKAFIKGAGYTDSALQRPVIGI
ANTGSSYNPCHGNAPQLIEAVKRGVMLAGGLPMDFPTISVHESFSAPTSMYLRNLMSMDT
EEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGIPAIQLITGSMLTGSHRSERVGACTDC
RRYWGKFRAEEIDAEEIADVNNQLVASVGTCSVMGTASTMACIAEALGMTVPGGASPPAV
TADRIRIAEQTGTEAVRMARERLTIDKILTPAAFENAMRVLLAIGGSTNGIVHLAAIAGR
MGYDIDLKALDRMGRDTPVLLDLKPSGDHYMEDFHHAGGMATLLRELKPLLNLDALTVTG
RTLGEEIDRAGPGFAQDVVRPRSNPIYPQGGIAVLQGNLAPGGAIIKQSAAHPRLMEHEG
RAVVFENAADLAHRIDSDDLDVTADDILVLKNIGPKGAPGMPEAGYIPIPRKLARAGVKD
IVRISDGRMSGTAFGTIVLHVTPESAVGGPLAHVHNGDRITLSVARRELTLQVSDEELAR
RARLHPVTEPTAERGYRKLFLTTVNQADQGVDFDFLRCATERGTIPGPRE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccaagacgccctccccggcccacgacatcactcccgccgacgccgaaagc
ggcatatcgaagggcctgaccaactacggcgaccgcggcttttcgctgttcctgcgcaag
gccttcatcaagggcgcgggctatacggactcggcgctgcagcgccccgtcatcggcatt
gccaacacgggcagcagctacaacccctgccacggcaacgcgccccagctgatcgaggcc
gtcaagcgcggcgtcatgctggcgggcggcctgcccatggacttccccaccatctcggtg
cacgaaagcttctcggcgccgaccagcatgtacctgcgcaacctcatgtccatggacacc
gaggagatgatccgcgcccagcccatggatgccgtcgtgctcatcggcggctgcgacaag
acggtgccggcccagttgatgggcgcggcctcggccggcatcccggccatccagctgatc
accgggtcgatgctcaccggctcgcaccgcagcgagcgcgtgggcgcctgcacggactgc
cgccgctactggggcaagttccgcgccgaggagatcgacgccgaagagatcgccgacgtg
aacaaccagctggtggccagcgtgggcacctgctcggtcatgggcacggccagcaccatg
gcctgcattgccgaggcgctgggcatgacggtgccgggcggcgcctcgccccccgccgtc
acggccgaccgcatccgcatcgccgaacagacaggcaccgaggccgtgcgcatggcgcgc
gagcgcctgaccatcgacaaaatcctcacgcccgctgccttcgagaacgccatgcgcgtg
ctgctggccatcggcggctccaccaacggcatcgtgcacctggccgccattgcggggcgc
atgggctatgacatcgacctcaaggccctggaccgcatgggccgcgacacgcccgtgctg
ctggacctcaagccctcgggcgaccactacatggaggacttccaccacgcgggcggcatg
gccacgctgctgcgcgagctcaagcccctgctgaacctggacgccctcaccgtcaccggc
cgcacgctgggcgaagagatcgaccgcgccggccccggctttgcgcaggacgtggtgcgc
ccgcgctccaaccccatctacccgcagggcggcatcgccgtgctgcagggcaacctggcg
ccgggcggcgccatcatcaagcagtcggccgcccatccccggctcatggagcatgaaggc
cgcgccgtggtcttcgagaacgcggccgacctggcccaccgcatcgacagcgacgatctg
gacgtgacggccgacgacatcctcgtgctcaagaacatcggccccaagggtgcgcccggc
atgcccgaggccggctacatccccatcccgcgcaagctggcgcgggccggagtcaaggac
atcgtgcgcatctccgacgggcgcatgagcggcacggccttcggcaccatcgtgctgcac
gtcacaccggagtcggccgtgggcgggccgctggcccatgtgcacaacggcgaccgcatc
acgctgtcggtggcgcggcgcgagctgacgctgcaggtcagcgacgaggaactggcccgc
cgcgcccggctccaccccgtgaccgagcccacggctgagcgcggctaccgcaagctcttt
ctcaccaccgtgaaccaggccgaccagggcgtggacttcgacttcctgcgctgcgccacc
gaacgcggcaccattcccggcccgcgcgaatag

DBGET integrated database retrieval system