KEGG   Delftia acidovorans: Daci_5832Help
Entry
Daci_5832         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_27 ExsD
Motif
Other DBs
NCBI-ProteinID: ABX38460
UniProt: A9C0Z7
Position
6489564..6490343
Genome map
AA seq 259 aa AA seqDB search
MPGSAARPPCPVRAISSDKMAFLSQPPVLMVAAASLPISLDAEPAPAADALGAMVAALEE
DVVFGRLHPRERLVEDDLMARFDVKRHIAREALAALDRMGLIERRKNVGALVRSFSTQEV
QELYELRGMLEVEAARKIPLPVPAERLERLTSIQQQHDAAVAEGNARLVFRINLAFHQEL
FALAGNDTLHKAITEYARQTHPIRFASLVSADYRERARQEHWQMIEALRAQDRDALVRLC
AEHLQPSRDAYLNAQLQRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcagcgcggcacgcccgccatgcccagtgagggccatcagttcggacaaaatg
gcgtttttgtcccaaccgcctgtcttgatggtcgctgccgcctcactgccgatttccctg
gatgccgaacccgcccccgcagccgacgccctgggcgccatggtggccgcgctggaagag
gacgtggtcttcggccggctgcacccgcgcgagcgcctggtcgaagacgacctcatggcc
cgcttcgacgtcaagcgccacatcgcccgcgaggccctggccgcgctggaccgcatgggc
ctcattgagcgccgcaagaacgtcggcgccctggtgcgctccttctccacccaggaagtg
caggagctgtacgagctgcgcggcatgctcgaagtggaggccgcgcgcaagatccccctg
cccgtgccggccgagaggctcgaacgcctgacctccatccagcagcagcacgacgccgcc
gtggccgaaggcaacgcgcgcctggtgttccgcatcaacctggcctttcaccaggaactg
tttgcgctggcgggcaacgacacgctgcacaaggccatcaccgaatacgcgcgccagacg
caccccatccgcttcgcctccctggtctcggccgactaccgcgagcgcgcacgccaggaa
cactggcaaatgatcgaagccctgcgcgcccaggaccgcgacgccctggtccgcctgtgc
gccgagcacctgcagccctcgcgcgatgcgtatctgaatgcgcagttgcagcggttgtag

DBGET integrated database retrieval system